KEGG   Rousettus aegyptiacus (Egyptian rousette): 107519586
Entry
107519586         CDS       T06036                                 
Symbol
MRAP
Name
(RefSeq) melanocortin-2 receptor accessory protein
  KO
K22398  melanocortin 2 receptor accessory protein
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04927  Cortisol synthesis and secretion
ray04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    107519586 (MRAP)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107519586 (MRAP)
SSDB
Motif
Pfam: MRAP FixQ
Other DBs
NCBI-GeneID: 107519586
NCBI-ProteinID: XP_016017896
LinkDB
Position
Unknown
AA seq 212 aa
MANRTNVSAPYNSFEYYLDYLDLIPVDEKKLRANKHSIVIVFWVSLAAFVVLLFLILLYM
SWSGSPQARNNVQQQPACPWSFCLNLPLCIRKHLLHHRTPRGTLQAPPSSAKEPGSTASG
PNQQGQQESPSAAPPATPQAHPALLWELALDGDPRGWSATRPVSLPLETEPPDCRTDTSK
PWPATAVNWSTQPNLDTRAPSASLFTRGRKYN
NT seq 639 nt   +upstreamnt  +downstreamnt
atggccaacaggaccaatgtctccgccccgtacaacagctttgaatactacctggactac
ctggacctcatccctgtggatgagaagaagctgagagccaacaaacattcgatcgtcatt
gtcttctgggtgagcctggctgccttcgtggtgctcctcttcctcatcctgctctacatg
tcctggtcaggctccccgcaggcgaggaacaatgtccagcagcagcccgcatgcccctgg
agtttctgtctcaacctccccctgtgtatccggaagcacctactgcatcacaggacgccc
cggggcaccctgcaggctccaccaagctctgccaaggaaccaggcagcacggcatccggc
cccaaccagcaggggcagcaggagagcccctctgctgcaccccccgctaccccccaggcc
caccctgctctcctctgggaactggccctcgatggggacccccgtggctggtcagcaaca
agaccagtgagcctccctctagagacggaacctcctgactgtagaactgacaccagcaaa
ccatggccagccactgctgtgaactggtcaactcaacccaacctggacacacgtgcacct
tctgcaagtctgtttacacgtggcaggaagtacaactag

DBGET integrated database retrieval system