KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108527840
Entry
108527840         CDS       T04641                                 
Symbol
ITGAX
Name
(RefSeq) integrin subunit alpha X
  KO
K06462  integrin alpha X
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04610  Complement and coagulation cascades
rbb04810  Regulation of actin cytoskeleton
rbb05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    108527840 (ITGAX)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    108527840 (ITGAX)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    108527840 (ITGAX)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:rbb04515]
    108527840 (ITGAX)
   04090 CD molecules [BR:rbb04090]
    108527840 (ITGAX)
Cell adhesion molecules [BR:rbb04515]
 Integrins
  Integrin alpha subunits
   108527840 (ITGAX)
CD molecules [BR:rbb04090]
 Proteins
  108527840 (ITGAX)
SSDB
Motif
Pfam: VWA Integrin_alpha2 FG-GAP VWA_2 FG-GAP_3 Integrin_alpha FG-GAP_2 VWA_CoxE
Other DBs
NCBI-GeneID: 108527840
NCBI-ProteinID: XP_017724843
LinkDB
Position
Un
AA seq 1154 aa
MTRTKAALLLFTALATSLGFNLDTEELTAFRVDSAGFGDSVVQYANSWVVVGAPQERTAA
NQTGSLYQCGYSTGACEPIGLQVPPEAVNMSLGLSLAATTSPPQLLACGPTVHHGCGRNM
YLTGLCFLLAPTQLTQRLPASGQECPRQELDIVFLIDGSGSISPGNFATMMNFVRAVISQ
FQRPSTQFSLMQFSSEFYVHFTFEEFRLTSNPLGLLASVHQLRGLTRTATAIQKVVRQLF
QASHGARGDATKILIVITDGKKEGDSLDYKDVIPMADAAGIIRYAVGVGSAFKNTNSWKE
LNDIASKPSQEHIFKVEDFDALKDIQNQLKEKIFAIEGTETTSSSSFELEMAQEGFSAVF
TPDGPILGAVGSFTWSGGAFLYPPNMNPTFINMSQENVDMRDSYLGYSTELAFWKGVQNL
VLGAPRYQHTGKAAIFIQVSGQWRLKAEVTGTQIGSYFGASLCSVDVDGDGSTDLILIGA
PHYYEQTRGGQVSVCPLPRGWRRWWCDAVLHGEQGHPWGRFGAALTVLGDVNGDKLTDVV
IGAPGEEENQGAVYLFHGALGPSIGPSHSQRIGGSQLSPRLQYFGQALSGGQDLTQDGLV
DLAVGARGQVLLLRTRPVLWVGVSMQFKPAEIPRSAFECREQVVSDQILGQSSICLYIDK
RSKNLLGSRDLQSSLTMDLALDPGRLSPRATFQETKNRSLSRVQVLGLQAYCETFTLLLP
TCVEDSVTPITLRLNFTLVGEPLSAFRNLRPMLAADAQRYFMASLPFEKNCGADHICQDN
LGISFSFPGLKTLLVGSNLELNAEVIVWNDGEDSYGTTITFSHPAGLSYRHVAESQEQGQ
LRSLRLTCDSAPAGSQGTWSTSCRINHLIFRGGAQITFLATFDVSPKAVLGDRLLLTANV
SSENNTPRTNKTTFQLELPLKYAVYTVASSHEQSTKYLNFSDSEEKESRVAMHRYQVNNL
GQRDLPVSINFWVPVELNQEAVWMEVEVSHPQNPSLRCSSEKITPPASDFLAYIQKNPVL
DCSIAGCLRFRCDVPSFSIQEELDFTLKGNLSFAWVRQTSQKKVSVVSVAEITFDTSVYS
QLPGQEAFMRAQTTTVLEKYEVHNPTPLIIGSSIGGLLLLALITAALYKVGFFKRQYKEM
MEEANGQIAPENGT
NT seq 3465 nt   +upstreamnt  +downstreamnt
atgaccaggaccaaggcagcgctcctcctgttcacagccttagcaacttctctgggtttc
aacttggacacagaggagctgacagccttccgtgtggacagcgctgggtttggagacagt
gtggtccagtatgccaactcctgggtggtggttggagccccccaagagagaacagctgcc
aaccaaacgggcagcctctaccagtgcggctacagcaccggtgcctgtgagcccattggc
ctgcaggtgcccccggaggccgtgaacatgtccctgggcctgtccctggcggctaccacc
agtcccccccagctgctggcctgcggccccaccgtgcaccatgggtgtgggaggaacatg
tacctgaccggactctgcttcctcctggcccccacccagctcacccagaggctcccggcg
tccgggcaggagtgcccaagacaggagctggacattgtgttcctgattgatggctcgggc
agcatctcccccggcaactttgccacgatgatgaacttcgtgagagctgtgataagccag
ttccagagacccagcacccagttttccctgatgcagttctccagtgaattctacgtacac
ttcacttttgaggaattcaggctcacctcaaaccccctcggcctgttggcttctgttcac
caactgagagggttgacacgcacggccactgccatccaaaaagtcgtgcgccaattgttc
caggcctcacacggggcccgtggggatgccactaaaattctcattgtcatcactgatggg
aagaaagaaggcgacagcctggattataaggatgtcatccccatggctgatgcagcaggc
atcatccgctatgcagttggggttggatcagcttttaaaaacacaaactcttggaaagaa
ttaaatgacattgcatcgaagccctcccaggaacacatatttaaagtggaggactttgat
gctctgaaagatattcaaaaccagctgaaggagaagatctttgccattgaaggtacggag
accacaagcagtagctccttcgaattggagatggcgcaggagggcttcagcgctgtgttc
acgcctgatggccccattctgggggctgtggggagcttcacctggtctggaggtgccttc
ctgtatcccccaaatatgaaccccaccttcatcaacatgtctcaggagaatgtggacatg
agggactcttacctgggttactccactgagctggctttctggaaaggggtgcagaacctg
gtcctgggggccccccgctaccagcacactgggaaggctgccatcttcatccaggtgtcc
gggcaatggaggctgaaggccgaagtcacggggacacagattggttcctacttcggggct
tccctctgctccgtggatgtggatggcgatggcagcactgacctgatcctcatcggggcc
ccccattactacgagcagacccgagggggccaggtgtccgtgtgtcctttgcccaggggg
tggagaaggtggtggtgtgatgctgttctccacggggagcagggccatccctggggtcgc
tttggggcagctctgacagtgctgggggacgtgaatggggacaagctgacggacgtggtc
atcggggccccaggagaggaagagaaccagggtgctgtctacctgtttcacggagccttg
ggacctagcatcggcccctcccacagccagcggatcgggggctcccagctctcccccagg
ctgcagtattttgggcaggcactgagcggcggtcaagacctcacccaggatggactggtg
gacctggctgtgggggcccggggccaggtgctcctgctcaggacaagacctgtgctctgg
gtaggggtgagcatgcagttcaaacctgctgagatccccaggtctgcatttgagtgtcgg
gagcaggtggtctctgaccagatcctgggacagtccagcatctgcctttacattgacaaa
cgttccaagaacctgcttgggagccgtgacctccaaagctctctgacgatggacctggct
ctcgaccctggccgcctgagtccccgtgccaccttccaggaaacaaagaaccggagtctg
agtcgagtccaagtcctcgggctgcaggcatactgtgaaaccttcaccctgctgctcccg
acctgcgtggaggactctgtgacccccatcaccttgcgtctgaacttcacgctggtgggc
gagcccctctctgccttcagaaacctgcggcctatgctggccgctgatgctcagagatac
ttcatggcctccctcccctttgagaagaactgtggagccgaccatatctgccaggacaat
ctcggcatctccttcagcttcccaggcttgaagaccctactggtggggagtaacctggag
ctgaacgcagaagtgatagtgtggaatgacggggaagactcctacggaaccaccatcacc
ttctcccacccagcaggactgtcctaccgccatgtggcagagagccaggaacaggggcag
ctgcgttccctgcgcctgacatgtgacagcgccccagctgggagccagggcacctggagt
accagctgcagaatcaaccacctcatcttccgtggtggtgcccagatcaccttcttggct
acctttgacgtctcccccaaggctgtcctgggagaccggctgcttctgacagccaatgtg
agcagtgagaacaacacccccaggacgaacaagaccaccttccagctggagctcccgctg
aagtatgccgtctacactgtggctagcagccacgaacaatccaccaagtacctcaacttc
tcagactctgaggagaaggagagccgtgtggccatgcacagataccaggttaataacctg
ggacagagggacctgcctgtcagcatcaacttctgggtgcctgtggagctgaaccaggag
gctgtgtggatggaggtggaggtctcccacccccagaacccatcccttcggtgctcctca
gagaaaatcacacccccagcgtctgacttcctggcatacattcagaagaatcccgtgctg
gactgctccattgctggctgcctgcggttccgctgtgatgtgccctccttcagcatccag
gaggagctggatttcaccctgaagggcaacctcagtttcgcctgggtccgccagacatcg
cagaagaaggtgtcggtcgtgagtgtggctgaaattacgtttgacacatccgtgtactcc
cagcttccaggacaggaggcatttatgagagctcagacgacaacggtgctggagaagtac
gaggtccacaaccccacccccctcatcataggcagctccattgggggtctgctgctgctg
gcgctcatcacagcagcactgtacaaagttggcttcttcaagcgtcagtacaaggaaatg
atggaggaggcaaatggacaaattgctccagaaaacgggacatag

DBGET integrated database retrieval system