KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108533070
Entry
108533070         CDS       T04641                                 

Gene name
IL33
Definition
(RefSeq) interleukin 33
  KO
K12967  interleukin 33
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04060  Cytokine-cytokine receptor interaction
rbb04217  Necroptosis
rbb04623  Cytosolic DNA-sensing pathway
rbb05164  Influenza A
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108533070 (IL33)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    108533070 (IL33)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    108533070 (IL33)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    108533070 (IL33)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rbb04052]
    108533070 (IL33)
Cytokines and growth factors [BR:rbb04052]
 Cytokines
  Interleukins
   108533070 (IL33)
SSDB
Motif
Pfam: IL33 AbfB
Other DBs
NCBI-GeneID: 108533070
NCBI-ProteinID: XP_017732938
UniProt: A0A2K6MJV8
LinkDB
Position
Un
AA seq 228 aa
MKPKMKYSTNKISTTKQKNTASKALCFKLGKSQQKAKEVCHVYFMKLRSGLTIKKEACYF
RRETTKRPSLKTGRKYKGHLVLAACQQQSTVECFAFGISGVPKYTRALHDSSITDKVLLS
YYESQHPSSESGDGVDGKMLMVTLSPTKDFWLQANNKEHSVELHKCEKPLPDQAFFVLHN
KPFNCVSFECKTDPGVFIGVKDNHLALIKVDSSENLYSENILFKLSEI
NT seq 687 nt   +upstreamnt  +downstreamnt
atgaagccaaaaatgaagtattcaaccaacaaaatttccacaacaaagcagaagaacaca
gcaagcaaagccttgtgtttcaagctgggaaaatcccaacagaaggccaaagaagtttgc
cacgtgtactttatgaagctccgctctggccttacgataaaaaaggaggcctgttacttt
aggagagaaaccaccaaaaggccttcactgaaaacaggtagaaagtacaaaggacatctg
gtactcgctgcctgtcaacagcagtctactgtggagtgctttgcctttggtatatcaggg
gtcccgaaatatactagagcacttcatgattcaagtatcacagataaggtgttactgagt
tactatgagtctcaacacccctcaagtgaatcaggtgatggtgttgatggtaagatgtta
atggtaaccctgagtcctacaaaagacttctggttgcaagccaacaacaaggagcactct
gtggagctccataagtgtgaaaaaccactgccagatcaggccttctttgtccttcataat
aagcccttcaactgtgtttcatttgaatgcaagactgatcctggagtgtttataggtgta
aaggataatcatcttgctctgattaaagtagactcttctgagaatttgtatagtgagaat
atcttgtttaagctctctgaaatttag

DBGET integrated database retrieval system