KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108536886
Entry
108536886         CDS       T04641                                 
Symbol
MRAP
Name
(RefSeq) melanocortin 2 receptor accessory protein
  KO
K22398  melanocortin 2 receptor accessory protein
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04927  Cortisol synthesis and secretion
rbb04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    108536886 (MRAP)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    108536886 (MRAP)
SSDB
Motif
Pfam: MRAP FixQ DUF420 EVC2_like
Other DBs
NCBI-GeneID: 108536886
NCBI-ProteinID: XP_017739459
UniProt: A0A2K6MAA5
LinkDB
Position
Un
AA seq 172 aa
MANGTNASAPYYSYEYYLDYLDLIPVDEKKLKAHKHSIVIAFWVSLAAFVVLLFLILLYM
SWSGSPQMKNSTKHHQTCPWSHSLSLQLCIQKCLLCHREPLGTSQAQASSVEPGSRTGPD
QPLRQGSASTLPLGVFQTHPTLLWELTLNGGPLVRSKPSEPPPGDRTPQLQS
NT seq 519 nt   +upstreamnt  +downstreamnt
atggccaacgggaccaatgcctctgccccatactacagctatgaatactacctggactat
ctggacctcattcccgtagacgagaagaagctgaaagcccacaaacattccatcgtgatc
gcattctgggtgagcctggctgccttcgtggtgctcctcttcctcatcctgctctacatg
tcctggtcgggctccccgcagatgaagaacagtaccaagcaccaccaaacatgcccctgg
agtcacagccttagcctccagctctgcatccagaagtgcctgctgtgccacagggaaccc
ctggggacctcacaggctcaggcgagttcagtggagccagggagcagaactggccctgac
cagccgctacgacaggggagcgcctccaccttgccccttggggttttccagacccacccc
actctcctctgggaactgaccctcaatgggggtcccctcgtcaggagcaagcccagcgag
cctccccctggagacaggacccctcaattgcagagctga

DBGET integrated database retrieval system