KEGG   Rhinopithecus bieti (black snub-nosed monkey): 108539396
Entry
108539396         CDS       T04641                                 
Symbol
TNFRSF8
Name
(RefSeq) TNF receptor superfamily member 8
  KO
K05145  tumor necrosis factor receptor superfamily member 8
Organism
rbb  Rhinopithecus bieti (black snub-nosed monkey)
Pathway
rbb04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:rbb00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108539396 (TNFRSF8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:rbb04050]
    108539396 (TNFRSF8)
   04090 CD molecules [BR:rbb04090]
    108539396 (TNFRSF8)
Cytokine receptors [BR:rbb04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   108539396 (TNFRSF8)
CD molecules [BR:rbb04090]
 Proteins
  108539396 (TNFRSF8)
SSDB
Motif
Pfam: TNFR_c6
Other DBs
NCBI-GeneID: 108539396
NCBI-ProteinID: XP_017743533
LinkDB
Position
Un
AA seq 500 aa
MPCAWNSSRVCECQPGMFCAVSAVNSCARCFFHSVCPAGMIVKFPGTAQKNTVCELASPG
LSPACASPENCKEPSSGTIPQAKPTPVSPATSNASTMPLRGGTRLAQEAASKLKRAPGSP
SSVGRPSSDPGLSPTQPCPQGSGDCRKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAW
NSSRVCECRPGMVCATSATNSCARCVPYPICAAETVTKPQDMAEKDTTFEAPHLGTQPDC
SPTPENGEAPASTSPTLSSLVDSQASKTLPIPTSAPIALSSTGKPVLDAGPVLFWVILVL
AVVVGSSTFLLCHRRACRKRIRQKLHLCYPAQTSRPKLELVDSRPRRSSTQLRSGAFVTE
PSAEELGLLSRPPKETCHKEGAACPESLPLRDASPAGAPRXPRDLPEPRVSTEHTNNRIE
KIYIMKADTVIVGTVKAELPEGQGLVGPAEPELEEELEADHAPHYPEQETEPPLGSCSDV
MLSVEEEGKEDPLPTAASGK
NT seq 1503 nt   +upstreamnt  +downstreamnt
atgccgtgtgcatggaactcctcccgtgtctgcgaatgtcaacctggcatgttctgtgcc
gtgtctgccgtcaactcctgtgcccgctgcttcttccattctgtctgcccagcagggatg
attgtcaagttcccaggcacagcgcagaagaacacggtttgtgagctggcttccccaggg
ctcagccctgcctgtgccagcccggagaactgcaaggaaccctccagtggcaccatcccc
caggccaagcccaccccggtgtccccagcaacctccaatgccagcaccatgcctctaaga
gggggcacccgcctcgcccaggaagctgcttctaaactgaaaagggctcccggctctccc
tcctctgtgggaaggcctagttcagatccaggtctgtccccaacgcagccgtgcccacag
gggtctggcgactgcaggaagcagtgtgagcctgactactacctggacgaggctggccgc
tgcacggcctgcgtgagctgttctcgagacgacctcgtggagaagacgccgtgcgcatgg
aactcctcccgcgtctgcgaatgtcgacctggcatggtctgtgccacatcagccaccaac
tcctgtgcccgctgtgtcccctacccaatctgtgcagcagagacagtcaccaagccccag
gatatggctgagaaggacaccacctttgaggcgccacacctggggacccagcctgactgc
agccccaccccagagaatggcgaggcgcctgccagcaccagccccactctgagctccctg
gtggactcccaggccagtaagacgctgcccatcccaaccagcgctcccatcgctctctcc
tccacagggaagcccgttctggatgcagggccagtgctcttctgggtgatcctggtgctg
gctgtggtggtcggctccagcaccttcctcctgtgccaccggagggcctgcaggaagcga
attcggcagaagctccacctgtgctacccggcccagacctcccggcccaagctagagctt
gtggattccagacccaggaggagctcaacgcagctcaggagtggtgcgtttgtgacagaa
cccagtgcggaagagctggggttactgagccggccaccgaaggagacctgccacaaagag
ggggcagcctgcccagagagcctgccgctgcgggatgccagcccggccggggcccctcgt
nnccccagggaccttcctgagccccgggtgtccacggagcacaccaataacaggattgag
aaaatctacatcatgaaggccgacactgtgatcgtgggaactgtgaaggcggagctgcca
gagggccagggcctggtagggccagcggagcccgagttggaggaggagctggaggcggac
catgccccccactaccccgagcaggagacagagccgcctctgggcagctgcagtgatgtc
atgctgtcagtggaagaggaagggaaagaagaccccttgcccacagctgcctctggaaag
tga

DBGET integrated database retrieval system