Rhizobium binae: J2J99_07455 Help Entry J2J99_07455       CDS       T07180                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism rbq  Rhizobium binae Pathway rbq01100   Metabolic pathways rbq01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rbq00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     J2J99_07455   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     J2J99_07455 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N Delta_lysin Motif Other DBs NCBI-ProteinID:  QSY83629 LinkDB All DBs Position 1536286..1536522 Genome browser AA seq 78 aa AA seqDB search MSDIAERVKKIVIDHLGVDADKVVESASFIDDLGADSLDTVELVMAFEEEFGVEIPDDAA DSILTVGDAVKFIEKAQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgcagaacgcgtaaagaaaattgttattgatcatcttggcgtcgatgcc gacaaggtcgtcgagagcgccagctttatcgacgatctgggcgccgactcgctcgacacg gtcgaacttgtcatggctttcgaagaagaattcggcgttgaaatccccgacgacgctgcc gactcgatcctgacggttggcgatgcagtgaagtttattgagaaggcccaggcctga

DBGET integrated database retrieval system