Rhizobium etli bv. mimosae Mim1: REMIM1_CH02346 Help Entry REMIM1_CH02346    CDS       T02778                                  Symbol folB Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism rel  Rhizobium etli bv. mimosae Mim1 Pathway rel00790   Folate biosynthesis rel01100   Metabolic pathways rel01240   Biosynthesis of cofactors Module rel_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:rel00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     REMIM1_CH02346 (folB) Enzymes [BR:rel01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      REMIM1_CH02346 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      REMIM1_CH02346 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      REMIM1_CH02346 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  AGS22127 UniProt:  S5SJ77 LinkDB All DBs Position complement(2330937..2331302) Genome browser AA seq 121 aa AA seqDB search MTTYTITLQNCAFFARHGVHDEEEFLGQRFFVDAELDVVAGEALESDSINDTVNYGIAFT VIEEIVTGKRRYLIEALALDIAKGLCQTFPQVRRAKITVRKPNAPVPGVLDFVQVSVEHF A NT seq 366 nt NT seq  +upstreamnt  +downstreamnt atgactacctacacgatcacgctgcagaactgcgccttcttcgcgcgccatggcgtgcat gacgaggaggaattcctcggccagcgcttcttcgtcgacgccgagctcgatgtcgtcgcc ggcgaggcgctggaaagcgattcgatcaacgacaccgtcaattacggcattgccttcacg gtgatcgaggagatcgtcaccggcaagcgacgctacctcatcgaagccctggcgctcgat atcgccaagggcctctgtcagacattcccgcaggtgcgccgggcgaagatcacggtgcgc aagccgaatgcgccggtgcccggcgtgctcgatttcgtgcaggtgagtgttgagcatttt gcctga

DBGET integrated database retrieval system