KEGG   Rhodococcus erythropolis PR4: RER_58810
Entry
RER_58810         CDS       T00881                                 

Definition
(GenBank) putative amidase
  KO
K19795  ureidomalonase [EC:3.5.1.95]
Organism
rer  Rhodococcus erythropolis PR4
Pathway
rer00240  Pyrimidine metabolism
rer01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rer00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    RER_58810
Enzymes [BR:rer01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.95  N-malonylurea hydrolase
     RER_58810
SSDB
Motif
Pfam: Amidase
Other DBs
NCBI-ProteinID: BAH36589
NITE: RER_58810
UniProt: C0ZV95
LinkDB
Position
complement(6352759..6354237)
AA seq 492 aa
MVHAADPVDESVSGAPENRELVMADAVTLSGLIRRREVSCVEVMDSFLDQIEVHNPAVNA
IVALRDREALTAEARERDSQLASGQYLGWMHGFPHAVKDLSAAKGLPFTSGSPMFADRIA
EEDDLFVKRIKSAGAIVIGKTNTPEFGLGSQTYNPVWGTTVSPYDNSRTAGGSSGGAAAS
LALRMLPVADGSDYMGSLRNPSAFNNVVGFRPSWGRIPETGFIAQGAVVGPMGRTVTDVA
HLLSTMAGPDAYAPLGIRENPAVFTESLARDLKGSRIAWVGDWNGYLATEPGVLELCESS
FEVFEQLGCRVEAALPDFKPEDIWQLFLRWRWWAQLGLIDQYNDPSLRELMKPELLWELG
HAVTLSALDVTKAAEARNGWLSAITKMFETYDYILAPSAQVFPFDKNTHWPETVDGRSMD
TYHRWMETVVPWTMAGVPVAGMPVGFDDRSLPMGIQIIGRHGADLDVLQLAYAFEQATQW
VERVLPPALRVN
NT seq 1479 nt   +upstreamnt  +downstreamnt
atggttcatgctgctgaccctgtcgacgagagcgtttccggtgcgcccgagaatcgcgag
ctcgtcatggccgatgcggtcacgctcagtggtctgatacgcaggcgtgaagtgtcgtgt
gtcgaggtgatggacagcttcctcgatcagatcgaagtacataacccggcggtgaacgcg
atcgtcgcattgcgggatcgggaagcgttgacggcggaggcgcgcgagcgtgattcgcag
ttggcgagtgggcagtatctcggttggatgcacgggtttccgcatgcggtgaaggatctt
tcggcagccaagggtctgccgttcacgtccgggtcgccgatgttcgcggatcgaatcgcc
gaagaggacgacctgttcgtcaagcggatcaagtctgccggtgccatcgtgatcggcaag
acgaacacaccggagttcgggctcggatcgcagacgtacaacccggtgtggggtacgacg
gtgtcgccttacgacaattcgcgcactgccggcggtagcagcggaggcgccgcagcgtcg
ttggcgcttcgcatgctgccggtggctgatggaagcgattacatgggttcgctccgaaac
ccgtcggcgttcaacaacgttgttgggtttcgaccttcctggggtcggataccggagacg
ggattcatcgctcagggcgctgttgtgggtccgatgggccgaaccgtcaccgacgtggct
cacctgctctccacgatggcgggaccggatgcctatgcgccgttggggattcgtgagaat
cccgctgttttcaccgaaagcctcgcacgggatctgaagggctctcggatcgcatgggtc
ggtgactggaacgggtacctggcaaccgaacctggagttctcgagttgtgcgaatcctcg
ttcgaggtcttcgaacagttggggtgccgcgtcgaggctgcgcttcccgacttcaaaccc
gaggacatctggcaactgttcctgcgatggcgttggtgggcgcagctcggtttgatcgat
cagtacaacgatccgagtttgcgtgagttgatgaagcccgaactgttgtgggaactcggg
catgcggtcaccctctcggcactcgacgtgaccaaggctgcggaggcccgcaacggctgg
ctgtcggccattaccaagatgttcgaaacctacgactacattctcgcgccgagtgctcag
gtgtttcctttcgacaagaacactcactggcccgagaccgtcgacgggcggtcgatggac
acgtatcaccggtggatggagacggttgttccctggacgatggccggggttccggttgcg
gggatgccggtcggcttcgacgatcgttcgcttcccatgggtatccagatcatcggtcgg
cacggcgcggacttggacgtactccaactcgcctacgcattcgagcaggcaacccagtgg
gtcgagcgggttcttcctcccgcactccgcgtgaactga

DBGET integrated database retrieval system