KEGG   Cupriavidus pinatubonensis JMP134: Reut_A0138
Entry
Reut_A0138        CDS       T00268                                 
Name
(GenBank) Thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00071  Fatty acid degradation
reu00280  Valine, leucine and isoleucine degradation
reu00310  Lysine degradation
reu00362  Benzoate degradation
reu00380  Tryptophan metabolism
reu00620  Pyruvate metabolism
reu00630  Glyoxylate and dicarboxylate metabolism
reu00650  Butanoate metabolism
reu00900  Terpenoid backbone biosynthesis
reu01100  Metabolic pathways
reu01110  Biosynthesis of secondary metabolites
reu01120  Microbial metabolism in diverse environments
reu01200  Carbon metabolism
reu01212  Fatty acid metabolism
reu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Reut_A0138
   00630 Glyoxylate and dicarboxylate metabolism
    Reut_A0138
   00650 Butanoate metabolism
    Reut_A0138
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Reut_A0138
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Reut_A0138
   00310 Lysine degradation
    Reut_A0138
   00380 Tryptophan metabolism
    Reut_A0138
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Reut_A0138
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Reut_A0138
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Reut_A0138
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:reu04147]
    Reut_A0138
Enzymes [BR:reu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Reut_A0138
Exosome [BR:reu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Reut_A0138
SSDB
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt DUF5789
Other DBs
NCBI-ProteinID: AAZ59520
UniProt: Q477B3
LinkDB
Position
1:164652..165833
AA seq 393 aa
MQDPIVIVSAARTPMAAFQGEFASLTAPQLGAVAIRAAVERAGIKPEQVEEVVFGCVLPA
GQGQAPARQAALGAGLPLSVGCTTVNKMCGSGMRAAMNVYDGLVAGSFDIAVAGGMESMT
NAPYLIPKGRGGYRIGHGMMYDHMMLDGLEDAYDKGRAMGTFGEDCAAKYGFTREQQDTF
AIESVRRAQQATEAGDFRWEIAPVTVSGKGGDTVIDTDEGPRRIKTDKIPSLKPAFAKDG
TITAASSSSINDGASALVMMRESTAKKLGLRPIARMLGHTTHAQAPGWFTTAPVEAMAKL
YRKLDWTTDSIDLFEINEAFAVVPMAAMHDLKIPREKVNIHGGACALGHPIGASGARIMT
TLIGALRKTGGKRGVASLCIGGGEATAVGIEIV
NT seq 1182 nt   +upstreamnt  +downstreamnt
atgcaagacccgatcgtcatcgtttccgccgcccgcacccccatggcggctttccagggc
gagttcgcatcgctgacggcgccgcagctcggcgcggtcgccatccgcgccgcagtggaa
cgcgcaggcatcaagcccgaacaggtcgaggaagtggtgttcggctgcgtgttgccggcc
ggtcagggccaggcgcccgcacgacaggcggcgctcggcgcgggtctgccgctcagcgtt
ggctgcaccaccgtcaacaagatgtgcggctcgggcatgcgtgcggccatgaacgtctat
gacgggctggtggcgggctcgttcgacatcgccgttgccggcggcatggagagcatgacc
aacgcgccgtacctgatcccgaaggggcgcggcggttaccgcatcggccacggcatgatg
tatgaccacatgatgctcgacggcctcgaagacgcgtacgacaagggccgcgcgatgggt
accttcggcgaagactgcgccgccaagtacggcttcacgcgcgagcagcaggacaccttc
gcgatcgaaagcgtgcgccgcgcgcagcaggccaccgaggctggcgacttccgctgggag
atcgcgccggtcaccgtgtcgggcaagggcggcgacaccgtcatcgataccgatgaaggc
ccgcgccgcatcaagaccgacaagatcccgtcgctgaagccggcgttcgccaaggacggc
accatcaccgccgcatcgtcgtcgtcgatcaacgacggcgcctcggcgctggtgatgatg
cgcgaatcgaccgccaagaaactgggcctgcggcccatcgcacgcatgcttggccacacc
acgcacgcgcaggcgccgggctggttcaccaccgcaccggtcgaggccatggccaagctg
taccgcaagctggactggaccaccgacagcatcgacctgttcgagatcaacgaggccttc
gccgtggtgccgatggctgcgatgcacgacctcaagatcccgcgcgagaaggtcaatatc
cacggcggcgcgtgtgcgctgggccatccgatcggcgcctcgggcgcacgcatcatgacc
acgctgatcggcgcgctgcgcaagacgggcggcaagcgtggcgtggccagcctgtgcatt
ggtggcggagaggcgacggcggttggtatcgagatcgtctga

KEGG   Cupriavidus pinatubonensis JMP134: Reut_A1348
Entry
Reut_A1348        CDS       T00268                                 
Name
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00071  Fatty acid degradation
reu00280  Valine, leucine and isoleucine degradation
reu00310  Lysine degradation
reu00362  Benzoate degradation
reu00380  Tryptophan metabolism
reu00620  Pyruvate metabolism
reu00630  Glyoxylate and dicarboxylate metabolism
reu00650  Butanoate metabolism
reu00900  Terpenoid backbone biosynthesis
reu01100  Metabolic pathways
reu01110  Biosynthesis of secondary metabolites
reu01120  Microbial metabolism in diverse environments
reu01200  Carbon metabolism
reu01212  Fatty acid metabolism
reu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Reut_A1348
   00630 Glyoxylate and dicarboxylate metabolism
    Reut_A1348
   00650 Butanoate metabolism
    Reut_A1348
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Reut_A1348
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Reut_A1348
   00310 Lysine degradation
    Reut_A1348
   00380 Tryptophan metabolism
    Reut_A1348
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Reut_A1348
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Reut_A1348
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Reut_A1348
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:reu04147]
    Reut_A1348
Enzymes [BR:reu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Reut_A1348
Exosome [BR:reu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Reut_A1348
SSDB
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt CMD
Other DBs
NCBI-ProteinID: AAZ60718
UniProt: Q472G5
LinkDB
Position
1:1449321..1450502
AA seq 393 aa
MTDIVIVSAARTAVGKFGGSLAKIPAPELGAIAIKAALERAGVKPEQVSEVIMGQVLTAG
SGQNPARQASIKAGLPSSVPAMTINKVCGSGLKAVMLAANAILAGEAEIVVAGGQENMSA
APHVLPGSRDGFRMGDAKLVDTMIVDGLWDVYNQYHMGITAENVAKEYGITREAQDEFAV
ASQNKAEAAQKAGKFDDEIVPVMIPQRKGDPVAFKTDEFVRQGATLDNMSGLKPAFDKAG
TVTAANASGINDGAAAVVVMSAAKAKELGLTPLATIKAYANAGVDPKVMGMGPVPASKRC
LSRAGWGVGDLDLMEINEAFAAQALAVHQQMGWDTSKVNVNGGAIAIGHPIGASGCRILV
TLLHEMKRRDAKKGLASLCIGGGMGVALAVERN
NT seq 1182 nt   +upstreamnt  +downstreamnt
atgaccgatatcgtcatcgtttccgccgcccgtaccgccgttggcaagtttggcggttcg
ctcgcgaagattcccgccccggaactgggcgcgatcgccatcaaggctgccctggaacgt
gcaggcgtgaagccggaacaggtcagcgaagtgatcatgggccaggtgctcacggccggt
tcgggccagaacccggcgcgccaggcatccatcaaggcgggcctgccctcgtcggtgccg
gccatgaccatcaacaaggtgtgcggctcgggcctgaaggccgtgatgctggccgccaac
gctatcctcgccggtgaagccgagatcgtcgtggccggcggccaggagaacatgagcgca
gcaccgcacgtgctgccgggctcgcgcgatggcttccgcatgggcgacgccaagctggtc
gacacgatgatcgtcgacggcctgtgggacgtgtacaaccagtaccacatgggcattacg
gcggagaacgtcgccaaggaatacggcattacccgcgaagcgcaggacgagttcgccgtg
gcctcgcaaaacaaggccgaggctgcgcagaaggccggcaagttcgatgatgaaatcgtc
ccggtgatgattccgcagcgcaaaggcgacccggtggcattcaagacggacgagttcgtc
cgccagggcgccacgctggacaacatgtcaggcctgaagcccgcctttgacaaggccggc
acggtgaccgccgccaatgcctcgggcatcaacgacggcgctgccgccgtggtggtgatg
tcggccgccaaggccaaggaactgggcctgaccccgctggccacgatcaaggcctacgcc
aatgccggcgtggacccgaaggtcatgggcatgggcccggtgccggcatccaagcgctgc
ctgtcgcgtgcaggttggggcgtgggcgacctggacctgatggaaatcaacgaggccttc
gccgcgcaggcgctggccgtgcaccagcagatgggctgggacacctccaaggtcaacgtg
aacggcggcgccattgccatcggtcacccgatcggtgcgtcgggctgccgtatcctggtg
acgctgctgcatgagatgaagcgccgcgatgcgaagaaggggctcgcctcgctgtgcatc
ggcggcggcatgggtgtggcgctggcggtcgagcgcaattaa

KEGG   Cupriavidus pinatubonensis JMP134: Reut_A1353
Entry
Reut_A1353        CDS       T00268                                 
Name
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00071  Fatty acid degradation
reu00280  Valine, leucine and isoleucine degradation
reu00310  Lysine degradation
reu00362  Benzoate degradation
reu00380  Tryptophan metabolism
reu00620  Pyruvate metabolism
reu00630  Glyoxylate and dicarboxylate metabolism
reu00650  Butanoate metabolism
reu00900  Terpenoid backbone biosynthesis
reu01100  Metabolic pathways
reu01110  Biosynthesis of secondary metabolites
reu01120  Microbial metabolism in diverse environments
reu01200  Carbon metabolism
reu01212  Fatty acid metabolism
reu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Reut_A1353
   00630 Glyoxylate and dicarboxylate metabolism
    Reut_A1353
   00650 Butanoate metabolism
    Reut_A1353
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Reut_A1353
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Reut_A1353
   00310 Lysine degradation
    Reut_A1353
   00380 Tryptophan metabolism
    Reut_A1353
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Reut_A1353
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Reut_A1353
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Reut_A1353
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:reu04147]
    Reut_A1353
Enzymes [BR:reu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Reut_A1353
Exosome [BR:reu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Reut_A1353
SSDB
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Other DBs
NCBI-ProteinID: AAZ60723
UniProt: Q472G0
LinkDB
Position
1:1455089..1456273
AA seq 394 aa
MTREVVVVSGVRTAIGTFGGSLKDMAPTQLGALVVREALARAQVSGDDVGHVVFGNVIQT
EPRDMYLGRVAAVDGGVTINAPALTVNRLCGSGLQAIVSAAQTILLGDADVAIGGGAESM
SRAPYLAPAVRWGARMGDASMVDMMLGALHDPFHRIHMGVTAENVAKEYDITRSQQDEAA
LESHRRASAAIKAGYFKDQIVPVTLKTRKGEVSFDTDEHVRHDATIDDMTKLKPVFVKEN
GTVTAGNASGLNDAAAAVVLMERAEAERRDLKPLARLVSYGHAGVDPKTMGIGPVPATKK
ALERAGLSVSDLDVIEANEAFAAQACAVTKALGLDPAKVNPNGSGISLGHPIGATGALIT
VKALHELQRVQGRYALVTMCIGGGQGIAAIFERI
NT seq 1185 nt   +upstreamnt  +downstreamnt
atgacgcgtgaagtcgtggtagtgagtggcgtacgtacggcaatcggcactttcggcggc
agcctgaaggacatggcaccgacccaactgggtgcactcgtggtgcgcgaggcgctggcc
cgtgctcaggtgtcgggcgacgatgttggtcacgtggtgttcggtaacgtgattcagacc
gagccgcgcgacatgtatctgggccgcgtggcggccgtcgatggcggtgtgacgatcaat
gcgcctgcgctgaccgtgaaccgcctgtgcggctcgggcctgcaagccatcgtcagcgcc
gcgcagaccattctgctcggcgacgccgacgtggccatcggcggcggtgcggaaagcatg
agccgcgcgccgtacctggcgcccgcagttcgctggggcgcgcgcatgggcgatgccagc
atggtcgacatgatgctgggcgcgctgcatgacccgttccaccgcattcacatgggtgtc
acggccgagaacgtggccaaggaatacgacatcacgcgcagccagcaggacgaagccgcg
ctggaatcgcaccgtcgcgcttcggccgcgatcaaggctggttacttcaaggaccagatc
gttccggtgacgctcaagacccgcaagggcgaggtgagcttcgacaccgacgagcacgtg
cgtcacgacgccacgatcgacgacatgaccaagctcaagccggtcttcgtcaaggaaaac
ggcaccgtgacggcgggcaatgcctccggcctgaacgacgccgctgcggctgtcgtgctg
atggagcgcgccgaagccgagcgccgtgacctgaagccgctggctcgcctggtgtcgtat
ggccacgctggcgtggatccgaagaccatgggtatcggcccggtgccggctaccaagaag
gcgctggagcgcgctggcctgtcggtgtccgacctggacgtgatcgaagccaacgaagcg
tttgccgcgcaggcttgcgcggtgaccaaggcgctgggcctggacccggccaaggtcaat
cccaacggttccggcatttcgcttggccacccgatcggcgccaccggcgcgctgatcacg
gtcaaggcgttgcatgagctgcaacgcgtgcagggccgctatgcgctggtgacgatgtgc
atcggcggcggccagggcattgccgccatcttcgagcgcatctga

KEGG   Cupriavidus pinatubonensis JMP134: Reut_A1407
Entry
Reut_A1407        CDS       T00268                                 
Name
(GenBank) Thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00071  Fatty acid degradation
reu00280  Valine, leucine and isoleucine degradation
reu00310  Lysine degradation
reu00362  Benzoate degradation
reu00380  Tryptophan metabolism
reu00620  Pyruvate metabolism
reu00630  Glyoxylate and dicarboxylate metabolism
reu00650  Butanoate metabolism
reu00900  Terpenoid backbone biosynthesis
reu01100  Metabolic pathways
reu01110  Biosynthesis of secondary metabolites
reu01120  Microbial metabolism in diverse environments
reu01200  Carbon metabolism
reu01212  Fatty acid metabolism
reu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Reut_A1407
   00630 Glyoxylate and dicarboxylate metabolism
    Reut_A1407
   00650 Butanoate metabolism
    Reut_A1407
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Reut_A1407
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Reut_A1407
   00310 Lysine degradation
    Reut_A1407
   00380 Tryptophan metabolism
    Reut_A1407
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Reut_A1407
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Reut_A1407
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Reut_A1407
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:reu04147]
    Reut_A1407
Enzymes [BR:reu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Reut_A1407
Exosome [BR:reu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Reut_A1407
SSDB
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt STAS_2
Other DBs
NCBI-ProteinID: AAZ60777
UniProt: Q472A6
LinkDB
Position
1:1522936..1524114
AA seq 392 aa
MNEAVIVSTARTGLAKSWKGAFNMTHGATLGGHAVEHAIARAKIEAGEVEDVLMGCANPE
GATGSNIARQIALRAGCPVTVPGATVNRFCSSGLQTIAMAAQRVIADEGDIFVAGGVESI
SCVQAEMNRHMLADPWLVKNKPEIYWNMLQTAENVAKRYNISKDRQDEYGVRSQQRAAAA
QEAGKFKDEIVPITVLAGVADKSTGQLVTKEVTLDRDEGIRGDTTLEAVSKIRTAVPGGV
VTAGNASQFSDGASAAVVMNARVAAAKGLQPLGVFRGFAVAGCEPDEMGIGPVFAVPKLL
KKAGLKVDDIGLWELNEAFAVQVLYCADKLGIPMDRLNVNGGAIAVGHPYGVSGARLVGH
ALIEGKRRGVKYVVVTMCIGGGQGAAGLFEVL
NT seq 1179 nt   +upstreamnt  +downstreamnt
atgaacgaggcagtcatcgtatccaccgcccgcaccgggctggccaagagctggaagggc
gcgttcaacatgacccatggcgcgacgctcggcggccacgccgtggagcacgccattgcg
cgcgcaaagatcgaagccggcgaagtggaagacgtgctgatgggctgtgccaaccccgaa
ggcgccaccggctccaacatcgcccgccagatcgcgctgcgtgctggttgcccggtcacc
gtgccgggtgcgaccgtgaaccgcttctgctcgtccggcctgcagaccattgctatggcg
gcgcagcgcgtgatcgccgatgaaggcgatatcttcgtggccggcggcgtggaaagcatc
tcctgcgtccaggcggaaatgaaccgccacatgctcgccgatccgtggctggtcaagaac
aagccggaaatctactggaacatgctccagaccgccgagaacgtggccaagcgctacaac
atctcgaaggatcgccaggacgagtatggcgtgcgcagccagcagcgcgccgccgccgcc
caggaagccggcaagttcaaggacgagatcgttccgatcacggtgctcgcaggcgtggcc
gacaagtccacgggccagttggtcacgaaggaagtgacgctggaccgcgacgaaggcatc
cgtggcgacaccacgctggaagccgtgtcgaaaatccgtactgccgtgccgggtggcgtg
gtcaccgccggcaatgcgtcgcagttctcggacggcgcttcggctgccgtggtgatgaac
gcgcgcgtcgctgccgccaagggcctgcagccgctgggcgtgttccgcggcttcgccgtg
gcgggttgcgagcccgatgaaatgggcatcggcccggtgttcgcggtgcccaagctgctg
aagaaggccggcctgaaggtcgacgacatcggcctgtgggaactgaacgaagccttcgcc
gtgcaggtgctgtactgcgccgacaagctgggcatcccgatggatcgcctgaacgtcaac
ggtggcgctatcgcggtgggccacccgtatggcgtgtcgggtgctcgcctggtcggccat
gcgctgattgaaggcaagcgccgtggcgtgaagtacgtcgtcgtgacgatgtgcatcggc
ggcgggcagggcgcggccgggttgttcgaagtgctgtaa

KEGG   Cupriavidus pinatubonensis JMP134: Reut_A1565
Entry
Reut_A1565        CDS       T00268                                 
Name
(GenBank) Thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00071  Fatty acid degradation
reu00280  Valine, leucine and isoleucine degradation
reu00310  Lysine degradation
reu00362  Benzoate degradation
reu00380  Tryptophan metabolism
reu00620  Pyruvate metabolism
reu00630  Glyoxylate and dicarboxylate metabolism
reu00650  Butanoate metabolism
reu00900  Terpenoid backbone biosynthesis
reu01100  Metabolic pathways
reu01110  Biosynthesis of secondary metabolites
reu01120  Microbial metabolism in diverse environments
reu01200  Carbon metabolism
reu01212  Fatty acid metabolism
reu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Reut_A1565
   00630 Glyoxylate and dicarboxylate metabolism
    Reut_A1565
   00650 Butanoate metabolism
    Reut_A1565
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Reut_A1565
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Reut_A1565
   00310 Lysine degradation
    Reut_A1565
   00380 Tryptophan metabolism
    Reut_A1565
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Reut_A1565
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Reut_A1565
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Reut_A1565
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:reu04147]
    Reut_A1565
Enzymes [BR:reu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Reut_A1565
Exosome [BR:reu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Reut_A1565
SSDB
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt SecD_SecF
Other DBs
NCBI-ProteinID: AAZ60931
UniProt: Q471K2
LinkDB
Position
1:1685747..1686904
AA seq 385 aa
MTMKHAYIVDALRTPTGRRKGGLSHMHGADLGGFVLAELVRRNDIPAEDYDDVVFGCVDT
IGPLAGNIARSAWLAAGLPLTVPGVTVDRQCGSSQQAVHFAAQAVMSGTQDVVIAGGVQT
MTQIPISSAMLAGQALGFSDPFSGSKGWHARFGDAPVSQFHAAQRIAEHWKLSREAMEAY
ALESHRRAAAAIEAGHFAREIVPCEGVKHDETPRPDTTLPKMAALEPLMPGSALTAAVSS
QTADSAAALLIVSEDALKRYQLTPRARIAHMSVMGDDPLWMLTAPIPATKRALERSGLSL
ADIDVVEINEAFASVAMAWLAETGYSAARTNPNGGAIALGHPLGATGARLMTTLLHELER
TGGRYGLQTMCEGGGLANVTIIERL
NT seq 1158 nt   +upstreamnt  +downstreamnt
atgaccatgaaacacgcctatatcgttgacgccctgcgcacgcccaccggccgccgcaag
ggcggactgtcgcacatgcacggcgcggacctcggcggcttcgtgctggccgagctggtg
cgccgcaacgacattcccgccgaggactatgacgacgtggtgttcggctgcgtcgacacc
attggcccgctggccggcaatatcgcccgcagcgcgtggctggccgccggcctgccgctg
accgtgccgggcgtgacggtggaccgccagtgcggttcgtcgcagcaggccgtgcacttt
gccgcgcaggcggtgatgagcggcacgcaggacgtcgtgatcgccggcggcgtgcagacc
atgacgcagatcccgatctcgtcggccatgctggcagggcaggcgttggggttctccgac
ccgttctcgggtagcaagggctggcacgcgcgtttcggcgatgcgccggtgtcgcagttc
cacgccgcgcagcgcatcgccgagcactggaagctgtcgcgcgaggccatggaagcgtac
gcgctggaaagccaccgccgcgccgcggctgcgatcgaggccggccacttcgcgcgggaa
atcgtgccgtgcgaaggcgtgaagcatgacgagacaccgcgccccgataccacgctgccc
aagatggccgcgctggagcctctgatgccgggcagcgcgctgaccgcggctgtatcaagc
cagactgccgattcggccgccgcgctgctgatcgtttccgaagacgcgctcaaacgctac
cagctcacgccgcgcgcacgcattgcgcatatgagcgtcatgggcgacgacccgctgtgg
atgctgaccgcgccgatcccggcgacgaagcgggcgctcgaacgcagcggcctgagcctg
gccgacatcgacgtggtggagatcaatgaagcctttgcctcggtggcgatggcctggctg
gcggagaccggctactccgccgcgcgcaccaatcccaacggaggcgccatcgcgctgggc
catccgctcggcgccaccggcgcacgcctgatgaccacgctgctgcatgaactggagcgc
accggcggccgctacggcctgcagaccatgtgcgaaggcggcggcctggcgaacgtcacc
atcatcgaacgactgtaa

KEGG   Cupriavidus pinatubonensis JMP134: Reut_A1572
Entry
Reut_A1572        CDS       T00268                                 
Name
(GenBank) Thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00071  Fatty acid degradation
reu00280  Valine, leucine and isoleucine degradation
reu00310  Lysine degradation
reu00362  Benzoate degradation
reu00380  Tryptophan metabolism
reu00620  Pyruvate metabolism
reu00630  Glyoxylate and dicarboxylate metabolism
reu00650  Butanoate metabolism
reu00900  Terpenoid backbone biosynthesis
reu01100  Metabolic pathways
reu01110  Biosynthesis of secondary metabolites
reu01120  Microbial metabolism in diverse environments
reu01200  Carbon metabolism
reu01212  Fatty acid metabolism
reu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Reut_A1572
   00630 Glyoxylate and dicarboxylate metabolism
    Reut_A1572
   00650 Butanoate metabolism
    Reut_A1572
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Reut_A1572
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Reut_A1572
   00310 Lysine degradation
    Reut_A1572
   00380 Tryptophan metabolism
    Reut_A1572
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Reut_A1572
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Reut_A1572
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Reut_A1572
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:reu04147]
    Reut_A1572
Enzymes [BR:reu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Reut_A1572
Exosome [BR:reu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Reut_A1572
SSDB
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Other DBs
NCBI-ProteinID: AAZ60938
UniProt: Q471J5
LinkDB
Position
1:1692399..1693604
AA seq 401 aa
MNEAVIVAVARTPIGKAFRGAFNDTEAPVLGGHVVRAVVERAGVDPAEVEDVLIGAAAQQ
GTQGYNLGRLCAVAAGLPDSVPGMTLDRMCGSGLMTIAAAARAIQCGEADILVAGGVESI
SLTQNKHKNAFRAQSEAVLAHQPAAYMAMIETAEVVARRYGISRAEQDAYAWRSQQRTAE
AQRRGAFDDEIVPLETRRALFDKSGVLTGHETVRLERDECNRPDTTAESLAALKPVWSGG
QAIAQGEYITAGNASQLSDGAAAVLLMSAKEAQRRGLRPLGRYRGMAVAGCAPDEMGIGP
VFAVPKLLERHGMTVADVGLWELNEAFASQVLYCQQKLGIADARLNVSGGAISVGHPFGM
SGARMTAHALIEGRRRGVRQAVVTMCIGGGMGAAALFDVLP
NT seq 1206 nt   +upstreamnt  +downstreamnt
atgaatgaagcagtcatcgtcgccgtcgcgcgcacgccgatcggcaaggccttccgcggc
gccttcaacgacaccgaagcccccgtgctgggcggtcatgtggtgcgtgcggtggtcgag
cgcgcgggcgtggacccggccgaggtggaagacgtactgatcggcgcggctgcgcagcag
ggcacccagggctataacctgggccgtctttgcgcggtggcggcgggcctgccggacagc
gtgcccggcatgaccttggaccgcatgtgcggctccggcctgatgaccattgccgcggcg
gcgcgtgcgatccagtgcggcgaggccgacatccttgtcgccggcggcgtggaatccatc
tcgctcacgcagaacaagcacaagaacgccttccgcgcccaatccgaagccgtactggcg
caccagcccgccgcctatatggcgatgatcgagaccgccgaagtggtcgcgcgccgttac
ggcatcagccgcgccgagcaggacgcctacgcctggcgcagccagcagcgcacggccgag
gcacaacgccgcggcgcctttgacgacgagatcgtgccgctggaaacgcgccgcgcgctg
ttcgacaagagcggcgtgctgaccgggcacgagaccgtgcggctggagcgcgacgaatgc
aaccggcctgacaccaccgccgaaagcctcgccgcactgaagccggtctggagcggcgga
caggcgatcgctcaaggcgaatacatcaccgcgggcaatgcgtcgcagctttccgatggc
gcggccgccgtactgctgatgagcgccaaagaggcacaacgtcgcggcctgcgcccgctg
ggccgctaccgcggcatggccgtggcgggctgcgcgcccgacgagatgggcatcggcccg
gtgttcgccgtgccgaagctgctggagcgccacggcatgacggtggccgacgtgggcttg
tgggagctgaacgaggcgtttgcgtcgcaggtgctgtattgccagcagaagctcggcatt
gccgatgcgcgcctgaacgtcagcggcggggcgatctcggtcggccacccgttcggcatg
tcgggtgcgcgcatgaccgcgcacgcgctgatcgagggccgccgccgcggtgtgcggcaa
gcggtggtgaccatgtgcatcggcggcggcatgggtgccgcggcgctgttcgacgtactg
ccctga

KEGG   Cupriavidus pinatubonensis JMP134: Reut_B3611
Entry
Reut_B3611        CDS       T00268                                 
Name
(GenBank) Thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00071  Fatty acid degradation
reu00280  Valine, leucine and isoleucine degradation
reu00310  Lysine degradation
reu00362  Benzoate degradation
reu00380  Tryptophan metabolism
reu00620  Pyruvate metabolism
reu00630  Glyoxylate and dicarboxylate metabolism
reu00650  Butanoate metabolism
reu00900  Terpenoid backbone biosynthesis
reu01100  Metabolic pathways
reu01110  Biosynthesis of secondary metabolites
reu01120  Microbial metabolism in diverse environments
reu01200  Carbon metabolism
reu01212  Fatty acid metabolism
reu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Reut_B3611
   00630 Glyoxylate and dicarboxylate metabolism
    Reut_B3611
   00650 Butanoate metabolism
    Reut_B3611
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Reut_B3611
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Reut_B3611
   00310 Lysine degradation
    Reut_B3611
   00380 Tryptophan metabolism
    Reut_B3611
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Reut_B3611
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Reut_B3611
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Reut_B3611
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:reu04147]
    Reut_B3611
Enzymes [BR:reu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Reut_B3611
Exosome [BR:reu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Reut_B3611
SSDB
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Other DBs
NCBI-ProteinID: AAZ62969
UniProt: Q46V65
LinkDB
Position
2:173280..174458
AA seq 392 aa
MAEAYIVGAVRTAGGRKGGKLAGWHPADLAAEVLNALLDRTGADPALIEDVIMGCVSQVG
EQAGNVARNAILASRLPESVPGTSVDRQCGSSQQALHFAAQAVMSGAMDIVIAAGVESMT
RVPMGLSSQLPAKNGFGVPKSPNVEQRYPGVQFSQFTGAEMIARNYGFSREDLDRYALQS
HQRAAAATRAGRFNAEIVPVEVRLADGTRNGEMHTADEGIRADATLESIGSVKLIAEGGR
VTAATASQICDGAAGLMVVNEAGLKKLGVKPLARVHHMTVIGHDPVIMLEAPLPATQHAL
KKAGMNINDIDLFEVNEAFAPVPLAWLKATGADPERLNIHGGAIALGHPLGGSGAKLMTT
LIHSLHTHGKRYGLQTMCEGGGLANVTIIERL
NT seq 1179 nt   +upstreamnt  +downstreamnt
atggcagaggcatacatcgttggcgcggtacgtaccgcaggcggacgcaagggcggcaag
ctggccggctggcatccggctgatctggcggcggaggtgctgaacgcgctgctcgaccgc
accggtgccgatcccgcgctcatcgaagacgtaatcatgggttgcgtgagccaggttggc
gagcaggccggcaacgtggcccgcaacgccattctggcgtcgcggctgcccgaaagcgtg
ccgggcacctcggtcgaccgccagtgcgggtcgtcgcagcaggcgttgcactttgccgcg
caggccgtgatgtcgggcgcgatggacatcgtcatcgcggcgggcgtggaaagcatgacg
cgcgtgccgatgggactgtcgtcgcaactgccggccaagaacggctttggcgtgccgaag
agcccgaatgtcgaacagcgctacccgggcgtgcagttcagccagttcacgggcgccgag
atgatcgcgcgcaactatggcttttcgcgcgaggatctcgaccgctatgcgctgcagagc
caccagcgcgccgccgctgcgacgcgtgcgggccggttcaatgccgagatcgtgccggtg
gaagttcgtctggccgacggcactcgcaatggcgagatgcacacggcggatgaaggtatt
cgtgcggacgccacgctggaatcgatcggcagcgtcaagctgatcgcagagggcggccgt
gtgaccgccgctacggccagccagatttgcgatggcgcggcgggcctgatggtcgtcaac
gaagccggcctgaagaagctgggcgtcaagccgctggcgcgcgtgcaccacatgaccgtg
atcggccacgatccggtgatcatgctcgaagcgccactgccggccacgcagcacgcgctg
aagaaggcaggcatgaacatcaacgacatcgacctgttcgaagtgaacgaggccttcgcg
ccggtgccgctcgcctggctgaaggccaccggtgccgatccggaacgcctgaacatccac
ggcggcgcgatcgcactgggccacccgctgggcggctcgggcgcaaagctgatgaccacg
ctgatccacagcctgcatacgcacggcaagcgttatggcttgcagaccatgtgtgaaggc
ggtgggctggccaacgtcaccattatcgagcgcctgtaa

KEGG   Cupriavidus pinatubonensis JMP134: Reut_B3829
Entry
Reut_B3829        CDS       T00268                                 
Name
(GenBank) acetyl-CoA acetyltransferase (thiolase)
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00071  Fatty acid degradation
reu00280  Valine, leucine and isoleucine degradation
reu00310  Lysine degradation
reu00362  Benzoate degradation
reu00380  Tryptophan metabolism
reu00620  Pyruvate metabolism
reu00630  Glyoxylate and dicarboxylate metabolism
reu00650  Butanoate metabolism
reu00900  Terpenoid backbone biosynthesis
reu01100  Metabolic pathways
reu01110  Biosynthesis of secondary metabolites
reu01120  Microbial metabolism in diverse environments
reu01200  Carbon metabolism
reu01212  Fatty acid metabolism
reu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Reut_B3829
   00630 Glyoxylate and dicarboxylate metabolism
    Reut_B3829
   00650 Butanoate metabolism
    Reut_B3829
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Reut_B3829
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Reut_B3829
   00310 Lysine degradation
    Reut_B3829
   00380 Tryptophan metabolism
    Reut_B3829
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Reut_B3829
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Reut_B3829
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Reut_B3829
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:reu04147]
    Reut_B3829
Enzymes [BR:reu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Reut_B3829
Exosome [BR:reu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Reut_B3829
SSDB
Motif
Pfam: Thiolase_C Thiolase_N DUF348
Other DBs
NCBI-ProteinID: AAZ63187
UniProt: Q46UJ7
LinkDB
Position
2:complement(439899..441065)
AA seq 388 aa
MSIKGKAYIVGAYEHPTRKAPDKSVAQLHAESAKGALEDAGLTLADVDGYFCAGDAPGLG
VLNMVDYLGLKLRHVDSTETGGSSYLVHVSHAAQAIAAGKCNVALITLAGRPRSEGSSGT
KPRAWGAGVPDQAFEAPFSPMTVNSYAMVAMRHMYEYGTTAEQLAWIKVAASHHAQHNPN
AMLRDVVTVEDVLNAPMISDPLRKLDCCVVSDGGGALIVARPEIAAKLNRPKIKVLGAGE
YVKGQMGGHVDLTWSGAKFSGAAAFAEAGVTPADIKYASIYDSFTITVLMQLEDLGFCKK
GEGGKFVMDGNLISGVGKLPFNTDGGGLCNNHPANRGGITKVIEAVRQLRGEAHPAVQVK
NCDIALAQGTGGLLGSRHGSATLILERE
NT seq 1167 nt   +upstreamnt  +downstreamnt
atgagcatcaaaggcaaggcatatatcgtcggggcctacgaacacccgacccgcaaggcg
ccggacaagtcggtcgcgcagctgcacgcggaaagcgccaagggcgcgctggaagacgcc
ggcctcacgctggccgacgtcgacggctacttctgcgccggcgacgcgccgggcctcggc
gtgctcaatatggtcgactacctcggtctcaagctgcgccatgtcgattccaccgagacc
ggcggctcgtcgtatctcgtgcatgtgtcgcacgccgcgcaggccattgccgcaggcaag
tgcaacgtcgcgctgatcacactggccggccgcccgcgctccgaaggctccagcggcacc
aagccgcgcgcctggggtgcgggcgttcccgaccaggccttcgaggcgcccttcagcccg
atgaccgtcaactcgtacgccatggtcgccatgcgccatatgtacgaatacggcaccacg
gccgaacagctcgcctggatcaaggtcgccgcatcgcaccacgcgcagcacaacccgaac
gcgatgctgcgtgatgtcgtgacggtggaagacgtgctgaacgcgccgatgatctcggac
ccgctgcgcaagctcgactgctgcgtggtgtccgacggcggcggcgccctgatcgtcgcg
cgcccggaaatcgccgcgaagctcaaccgtccgaagatcaaggtgctgggcgccggcgaa
tatgtgaagggccagatgggcggtcatgtcgacctgacgtggtccggcgcgaaattctct
ggcgcagcggcgttcgccgaagctggcgtgacgccggccgacatcaaatacgcctcgatc
tacgacagcttcacgatcaccgtgctgatgcagctggaagatctcggcttctgcaagaag
ggcgaaggcggcaagttcgtgatggacggcaatctgatctcaggcgtcggcaagctgccg
ttcaacaccgatggcggtggcctgtgcaacaaccacccggccaaccgcggcggcatcacc
aaggtgatcgaagcggtgcgccagctgcgtggcgaggcgcatccggcggtgcaggtgaag
aactgcgacatcgccctggcccagggtaccggcggcctgctcggctcgcgccacggcagc
gccaccctgatcctcgagcgcgagtaa

KEGG   Cupriavidus pinatubonensis JMP134: Reut_B4152
Entry
Reut_B4152        CDS       T00268                                 
Name
(GenBank) acetyl-CoA acetyltransferase (thiolase)
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00071  Fatty acid degradation
reu00280  Valine, leucine and isoleucine degradation
reu00310  Lysine degradation
reu00362  Benzoate degradation
reu00380  Tryptophan metabolism
reu00620  Pyruvate metabolism
reu00630  Glyoxylate and dicarboxylate metabolism
reu00650  Butanoate metabolism
reu00900  Terpenoid backbone biosynthesis
reu01100  Metabolic pathways
reu01110  Biosynthesis of secondary metabolites
reu01120  Microbial metabolism in diverse environments
reu01200  Carbon metabolism
reu01212  Fatty acid metabolism
reu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Reut_B4152
   00630 Glyoxylate and dicarboxylate metabolism
    Reut_B4152
   00650 Butanoate metabolism
    Reut_B4152
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Reut_B4152
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Reut_B4152
   00310 Lysine degradation
    Reut_B4152
   00380 Tryptophan metabolism
    Reut_B4152
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Reut_B4152
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Reut_B4152
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Reut_B4152
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:reu04147]
    Reut_B4152
Enzymes [BR:reu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Reut_B4152
Exosome [BR:reu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Reut_B4152
SSDB
Motif
Pfam: Thiolase_N Thiolase_C
Other DBs
NCBI-ProteinID: AAZ63506
UniProt: Q46TM8
LinkDB
Position
2:791910..793079
AA seq 389 aa
MTIKGTAYIVGAYEHPTRKAPDKSAAQLHAESARGALEDAGLSLSDVDGYFCAGDAPGLG
AVNMVDYLGLKVRHVDSTDTGGSAYLVHVSHAAQAIAAGKCNVALITLAGRPRSEGSSGT
QARNWGANLPDAPFEAPLNAVTVNLYGMVAMRHMYEYGTTPEQLAWIKVAASHHAQHNPH
AMLRDVVTVEDVLNSPMISDPLRKLDCCVVSDGGGALIVARREIAAKLDRPRIRVLGAGE
HVKGQLGGEVDLSWSAARVSGAAAFAEAGVTPTDIKYASIYDSFTITVLMQLEDLGFCKK
GDGGKFVMDGNLISGVGKLPINTDGGGLCNNHPANRGGITKVIEAVRQLRGEAHPAVQVP
NCDLALAQGTGGYLGSRHGSATLILERDQ
NT seq 1170 nt   +upstreamnt  +downstreamnt
atgaccatcaaaggcacagcctatatcgtcggagcctacgagcatccgacccgcaaggca
ccggataagagcgcggcgcaactgcatgccgaaagcgcgcgcggtgcgctcgaagatgcc
ggactatcgttgtccgacgtcgacggctacttctgtgcgggcgacgcgccggggctcggc
gcggtcaatatggtcgactatctcggccttaaggtccgccatgtcgattccaccgatacc
ggcggctccgcctacctcgtgcatgtctcgcacgccgcgcaggcgatcgcggccggcaag
tgcaacgtggcgctgatcacgctggccggccggccgcgttcggaaggctccagcggcacg
caggcgcgcaactggggcgccaacctgcccgatgcgccgttcgaggcgcccctcaacgcg
gtcaccgtgaacctctacggcatggtggccatgcgccatatgtacgagtacggcaccacg
cccgagcagcttgcctggatcaaggtggcggcgtcgcaccacgcgcagcacaacccgcat
gcgatgctgcgcgacgtggtgacggtggaagacgtgctgaactcgccgatgatctccgac
ccgctgcgcaagctcgactgctgcgtggtctcggacggcggcggcgcgctgatcgtggca
cgtcgcgagattgcagcaaagctggaccgtccgcgcatccgcgtgctgggcgcgggcgag
cacgtcaaaggccagcttggcggcgaggtggacctgagctggtccgccgcacgcgtatcg
ggcgcggcggcgtttgccgaagctggcgtgacgccgaccgacatcaagtacgcctcaatc
tacgacagcttcacgatcaccgtgctgatgcaactggaagatctcggcttctgcaagaag
ggagacggcggcaagttcgtgatggacggcaacctgatctccggcgtcggcaagctgccc
atcaataccgatggcggcggcctgtgcaacaaccatcccgccaaccgcggcggcatcacc
aaggtgatcgaagccgtgcgccagctgcgtggcgaggcccatcccgctgtgcaggtgccc
aactgcgaccttgcactcgcgcaaggcacgggcggctacctcggcagccggcacggcagc
gccacgctgatcctggaacgcgatcaatga

KEGG   Cupriavidus pinatubonensis JMP134: Reut_B4561
Entry
Reut_B4561        CDS       T00268                                 
Name
(GenBank) Thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00071  Fatty acid degradation
reu00280  Valine, leucine and isoleucine degradation
reu00310  Lysine degradation
reu00362  Benzoate degradation
reu00380  Tryptophan metabolism
reu00620  Pyruvate metabolism
reu00630  Glyoxylate and dicarboxylate metabolism
reu00650  Butanoate metabolism
reu00900  Terpenoid backbone biosynthesis
reu01100  Metabolic pathways
reu01110  Biosynthesis of secondary metabolites
reu01120  Microbial metabolism in diverse environments
reu01200  Carbon metabolism
reu01212  Fatty acid metabolism
reu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Reut_B4561
   00630 Glyoxylate and dicarboxylate metabolism
    Reut_B4561
   00650 Butanoate metabolism
    Reut_B4561
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Reut_B4561
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Reut_B4561
   00310 Lysine degradation
    Reut_B4561
   00380 Tryptophan metabolism
    Reut_B4561
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Reut_B4561
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Reut_B4561
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Reut_B4561
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:reu04147]
    Reut_B4561
Enzymes [BR:reu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Reut_B4561
Exosome [BR:reu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Reut_B4561
SSDB
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Other DBs
NCBI-ProteinID: AAZ63911
UniProt: Q46SH3
LinkDB
Position
2:complement(1239536..1240717)
AA seq 393 aa
MQNPVKESIVIVGAKRTPIGAFNGSLAAHSAPELGAIAIRAAVAQVGVDPASVDEAIMGL
CLFAGVGQAPARQAVLGAGLPTSTPATTLSKMCGSGMKSVMLAHDLLLAGTCNVAVAGGM
ESMTNAPHIVPRGRHGYRLGHGQLLDHMYCDGLEDAYEGHLMGHYADLAAAERGIGREAQ
DAYARESLQRAQAAVAEGRFSDEIAPVALKRGGELAQDETPGQCDAEKLPKLKAVFRSGG
TVTAGNASSISDGAAALVLMRESDARRQGLAPLARIVAHATHANPPQQFADAPVHAARRV
LDKAGWTARDVDLYEINEAFAVVTMIALDELGIGHDRLNVNGGACALGHPVGATGARLLV
TLLHALKQRGGQRGLASLCLGGGEAVAVGVELC
NT seq 1182 nt   +upstreamnt  +downstreamnt
atgcaaaaccctgtgaaggaatctatcgtcatcgtcggcgcgaagcgcacgccgattggc
gcgttcaatggctccctggccgcacacagcgcgcccgaactcggcgccatcgccatccgc
gcggccgtggcgcaggtcggcgtcgatccggcgtcggtcgatgaagcgatcatgggcctg
tgcctgttcgcgggcgtcggccaggctccggcccggcaggctgtgcttggcgccggcctg
ccgacctcgacaccggccacgaccctgagcaagatgtgcggctcgggcatgaagtcggtg
atgctcgcgcatgatctgctgctcgccggcacgtgcaatgtggcagtggcgggcggcatg
gaatcgatgaccaatgcgccgcacatcgttccgcgcggccgtcacggctaccggctcggc
catgggcagttgctcgatcacatgtactgcgatggcctggaggacgcctacgaaggccac
ctgatgggccattacgcggacctggccgcggcggagcgcggcatcggccgcgaggcgcag
gacgcctatgcccgcgaaagcctgcagcgtgcgcaggccgcagtggccgaagggcgcttc
agcgacgagatcgcgccggtcgcgctgaagcgcggcggcgagctggcacaggacgagacg
ccgggccagtgcgacgccgagaagctgcctaagctgaaggcagtgttccgttccggcggc
acggtgacggccggcaatgcgtcttcgatctccgacggcgctgcggcgctggtgctgatg
cgagaaagcgacgctcgccgccagggcctggcgccgctggcccgcatcgttgcgcacgct
acgcacgccaacccgccgcagcagttcgccgatgcgcccgtgcatgcggcgcgccgcgtg
ctcgataaggcgggctggaccgcgcgcgatgtggacctctacgagatcaacgaggccttc
gccgtggtgacgatgatcgcgctggacgaacttggcattggccatgaccgcctcaacgtc
aacggcggcgcctgcgcgctcggtcatcccgtcggcgccaccggtgcgcgcctgctggtc
acgctgctccatgcgctgaagcagcgcggcggccagcgcggtctcgcgagcctgtgcctt
ggcggcggtgaggccgtggcagtcggcgtggaactttgctga

DBGET integrated database retrieval system