KEGG   Cupriavidus pinatubonensis JMP134: Reut_A0521
Entry
Reut_A0521        CDS       T00268                                 
Name
(GenBank) Carboxymuconolactone decarboxylase
  KO
K01607  4-carboxymuconolactone decarboxylase [EC:4.1.1.44]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00362  Benzoate degradation
reu01100  Metabolic pathways
reu01120  Microbial metabolism in diverse environments
reu01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Reut_A0521
Enzymes [BR:reu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.44  4-carboxymuconolactone decarboxylase
     Reut_A0521
SSDB
Motif
Pfam: CMD
Other DBs
NCBI-ProteinID: AAZ59903
UniProt: Q475N0
LinkDB
Position
1:567183..567593
AA seq 136 aa
MTTPVDTSAYTDNPAFEAGVNARTEVLGPAHVQRALDAAAQQGDTSLQQLVTEFAWGTVW
TREGLDRKQRSLATVSMLIALNRPQELAGHLRGALANGVTPQELRELMVHSAVYCGFPAA
LDASRKLTEVLEAAGA
NT seq 411 nt   +upstreamnt  +downstreamnt
atgaccacgccagtcgatacatccgcctataccgacaacccggccttcgaggccggcgtc
aacgcgcgcacggaagtcctgggcccggcccacgtgcagcgcgcgctggacgccgccgcc
cagcagggcgatacgagcctgcagcaactggtgaccgagtttgcatggggcacggtctgg
acccgcgaaggactggaccgcaagcagcgcagcctggcgacggtgtcgatgctgatcgcg
ctgaaccgtccgcaagaactggccggccacctgcgcggcgcgctggccaacggcgtcacg
ccgcaggaactgcgcgaactgatggtgcatagcgcggtgtactgcggctttccagccgcg
cttgacgccagccgcaagctcaccgaagtgctggaagccgcgggcgcatag

KEGG   Cupriavidus pinatubonensis JMP134: Reut_B5022
Entry
Reut_B5022        CDS       T00268                                 
Name
(GenBank) 3-oxoadipate enol-lactonase
  KO
K14727  3-oxoadipate enol-lactonase / 4-carboxymuconolactone decarboxylase [EC:3.1.1.24 4.1.1.44]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00362  Benzoate degradation
reu01100  Metabolic pathways
reu01120  Microbial metabolism in diverse environments
reu01220  Degradation of aromatic compounds
Module
reu_M00568  Catechol ortho-cleavage, catechol => 3-oxoadipate
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Reut_B5022
Enzymes [BR:reu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.24  3-oxoadipate enol-lactonase
     Reut_B5022
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.44  4-carboxymuconolactone decarboxylase
     Reut_B5022
SSDB
Motif
Pfam: CMD Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Abhydrolase_4 Ndr Esterase Ser_hydrolase FSH1
Other DBs
NCBI-ProteinID: AAZ64370
UniProt: Q46R64
LinkDB
Position
2:complement(1754195..1755385)
AA seq 396 aa
MPYLDHAGARLYYTVDGPDNAPAILFSNSLGTDHTMWQPQADALAGRFRVVRYDTRGHGR
STAPGDAFTMDQLGGDAIAILEALGIAQAVFCGVSMGGLTGMWLGVHAPERFPKIVLANT
AAKIGNADGWNSRIEGVLRNGMRPMVAPSIERWFTPGFAATASRAIDPLLTVLAGLDPRG
YAANCAAVRDADFRDAVRTIRVPVLVIAGSDDPSTSAQEGRELAAAIPDARFVELPAAHI
SNFEQPGRFTAALLDFIVGRLPVTDDHARYDAGLSVRRDVLGSDHVDRSIARLTPLNEEF
QNLITRYAWGEIWTREGLPRHTRSLLTIAMMVALNRSDELKLHLRAAANNGVRRDEIKEV
LLQTAIYCGVPAANSAFHMAEEVFAAIDEANRRPQA
NT seq 1191 nt   +upstreamnt  +downstreamnt
ttgccttacctcgaccatgccggcgcccggctttactacaccgtggacggccccgacaac
gcgccggccatcctcttctccaactcgctcggcaccgaccacaccatgtggcagccgcag
gccgacgccctggccggacgcttccgcgtggtgcgctacgacacgcgcggccacggccgt
tccaccgcgccgggcgacgccttcaccatggatcagcttggcggcgatgccatcgctatc
ctggaggcgctcggcatcgcgcaggcggtgttctgcggcgtgtcgatgggcggcctgacc
ggcatgtggctgggcgtgcatgcgcccgagcgcttcccgaagatcgtgcttgccaacacc
gccgcgaaaattggcaatgcggatggctggaactcgcgcatcgaaggcgtgctgcgcaac
ggcatgcgccccatggtggcgccttccatcgaacgctggttcaccccgggctttgccgcc
acggcaagccgagccatcgacccgctgctcacagtgctggccggactcgatccgcgcggc
tatgccgccaactgcgccgcggtgcgcgacgcggatttccgtgatgccgtacgcacgatc
cgcgtgcccgtactggtgatcgcgggcagcgacgatccatccacgtccgcgcaggaaggc
cgcgagcttgccgccgcgattcccgatgcgcgcttcgtcgaattgcctgccgcacacatc
tccaacttcgaacagccgggccgctttactgccgcgctacttgatttcatcgtcggccgc
ctgccggtcaccgatgatcacgcccgctatgatgcaggcctgtccgtacggcgcgacgta
ctcggcagcgaccacgtcgatcgctcgatcgcgcgcctgacaccgctcaatgaggaattc
cagaacctgatcacccgctatgcatggggcgagatctggacgcgcgaagggctgccgcgg
cacacgcgcagcctgctgaccattgcgatgatggtggcgctgaaccgctccgacgaactg
aagctgcacttgcgcgccgccgccaacaacggcgtgaggcgcgacgagatcaaggaagtg
ctactgcagaccgccatctactgcggcgtgccggctgcgaactcggccttccatatggcc
gaggaagtgttcgccgccatcgacgaggccaaccgccggccgcaggcctga

KEGG   Cupriavidus pinatubonensis JMP134: Reut_B5696
Entry
Reut_B5696        CDS       T00268                                 
Name
(GenBank) Carboxymuconolactone decarboxylase
  KO
K01607  4-carboxymuconolactone decarboxylase [EC:4.1.1.44]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00362  Benzoate degradation
reu01100  Metabolic pathways
reu01120  Microbial metabolism in diverse environments
reu01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Reut_B5696
Enzymes [BR:reu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.44  4-carboxymuconolactone decarboxylase
     Reut_B5696
SSDB
Motif
Pfam: CMD
Other DBs
NCBI-ProteinID: AAZ65041
UniProt: Q46P93
LinkDB
Position
2:2525597..2525989
AA seq 130 aa
MSAERYKQGLRMLAAVDGETGIEVVETLAKSFPVFARYVVEFPFGDIYSRGGLGLREREL
ATVAALCALGNALPQLRVHVHAALHVGCKPAEVVEAVMQMAVYAGFPAALNGLSVVREVF
AEKGIALPLD
NT seq 393 nt   +upstreamnt  +downstreamnt
atgagcgccgaacgttacaagcaaggtttgcggatgctggctgccgtcgatggtgagacg
ggcatcgaggtcgtcgaaacgctggcaaaatcgtttccggtctttgcacggtatgtggtc
gagtttccgtttggcgacatctactcccggggtgggctcggcttgcgggaaagggagttg
gctaccgtcgcggcgctttgcgcgctaggcaatgcgttaccgcagcttcgtgtgcatgtc
catgccgcattgcatgtcggttgcaagccggcggaggtcgtggaagcggtaatgcagatg
gcggtctatgcaggatttccggcagcgttgaacggactgtccgtcgtacgggaggtattc
gccgagaaagggatcgcgttaccgttggattga

DBGET integrated database retrieval system