KEGG   Cupriavidus pinatubonensis JMP134: Reut_A0855
Entry
Reut_A0855        CDS       T00268                                 
Name
(GenBank) 4-oxalocrotonate tautomerase
  KO
K01821  4-oxalocrotonate tautomerase [EC:5.3.2.6]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00362  Benzoate degradation
reu00621  Dioxin degradation
reu00622  Xylene degradation
reu01100  Metabolic pathways
reu01120  Microbial metabolism in diverse environments
reu01220  Degradation of aromatic compounds
Module
reu_M00569  Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Reut_A0855
   00622 Xylene degradation
    Reut_A0855
   00621 Dioxin degradation
    Reut_A0855
Enzymes [BR:reu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.2  Interconverting keto- and enol-groups
    5.3.2.6  2-hydroxymuconate tautomerase
     Reut_A0855
SSDB
Motif
Pfam: Tautomerase Tautomerase_2
Other DBs
NCBI-ProteinID: AAZ60234
UniProt: Q474E9
LinkDB
Position
1:927131..927334
AA seq 67 aa
MPYVNIRITREGTTAAQKAQLIRGATQLLADVLGKDPRSTVVVIDEVDPDNWGFAGETTT
ERRKAGR
NT seq 204 nt   +upstreamnt  +downstreamnt
atgccatatgtgaacatccgcatcacccgggaaggcacgaccgccgcacagaaggcgcag
ttgattcggggcgccacgcaactcctggctgacgtgctcggcaaggatccacgctctacc
gtggtggtcatcgacgaggtcgatccggataactggggctttgcgggcgaaaccaccacg
gagcgccgcaaggcgggccggtga

KEGG   Cupriavidus pinatubonensis JMP134: Reut_A0858
Entry
Reut_A0858        CDS       T00268                                 
Name
(GenBank) 4-oxalocrotonate tautomerase
  KO
K01821  4-oxalocrotonate tautomerase [EC:5.3.2.6]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00362  Benzoate degradation
reu00621  Dioxin degradation
reu00622  Xylene degradation
reu01100  Metabolic pathways
reu01120  Microbial metabolism in diverse environments
reu01220  Degradation of aromatic compounds
Module
reu_M00569  Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Reut_A0858
   00622 Xylene degradation
    Reut_A0858
   00621 Dioxin degradation
    Reut_A0858
Enzymes [BR:reu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.2  Interconverting keto- and enol-groups
    5.3.2.6  2-hydroxymuconate tautomerase
     Reut_A0858
SSDB
Motif
Pfam: Tautomerase Tautomerase_2
Other DBs
NCBI-ProteinID: AAZ60237
UniProt: Q474E6
LinkDB
Position
1:929492..929680
AA seq 62 aa
MPTFHVEMFEGRTIEQKRTFVDAVTRVTCETLGCEPAAVDIIITDVKRENWATGGELWAD
KK
NT seq 189 nt   +upstreamnt  +downstreamnt
atgccgacgtttcacgtagagatgtttgaaggccgcaccatcgaacagaagcgcacgttc
gtcgacgccgtgacgcgcgtcacctgcgagacgctgggctgcgagcccgcggccgtggac
atcatcatcaccgacgtcaagcgcgagaactgggccaccggcggcgagctgtgggccgac
aagaagtaa

KEGG   Cupriavidus pinatubonensis JMP134: Reut_A2880
Entry
Reut_A2880        CDS       T00268                                 
Name
(GenBank) 4-oxalocrotonate tautomerase
  KO
K01821  4-oxalocrotonate tautomerase [EC:5.3.2.6]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00362  Benzoate degradation
reu00621  Dioxin degradation
reu00622  Xylene degradation
reu01100  Metabolic pathways
reu01120  Microbial metabolism in diverse environments
reu01220  Degradation of aromatic compounds
Module
reu_M00569  Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Reut_A2880
   00622 Xylene degradation
    Reut_A2880
   00621 Dioxin degradation
    Reut_A2880
Enzymes [BR:reu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.2  Interconverting keto- and enol-groups
    5.3.2.6  2-hydroxymuconate tautomerase
     Reut_A2880
SSDB
Motif
Pfam: Tautomerase
Other DBs
NCBI-ProteinID: AAZ62241
UniProt: Q46X92
LinkDB
Position
1:3156096..3156488
AA seq 130 aa
MPHINLQISGQPDAALTRRSAAAVSEITQRVLGKKPDVIAIAVQYVPREQWIIGGEALSD
TGRNAFHLDISVTDETNTKAEKAAYLKAVFEALSELIGNVHPVSYIHVIDARAAAYGYGG
LTQEYRHQHG
NT seq 393 nt   +upstreamnt  +downstreamnt
atgccccacatcaacctgcagatctccggccagcccgacgccgccctcacccgccgcagc
gccgccgcggtgtccgaaatcacgcaacgcgtgctcggcaagaagcccgatgtcatcgcc
atcgcggtccagtacgtgccgcgcgagcagtggatcattggcggcgaggcgctgtctgat
accgggcgcaatgcgttccatctcgatatcagcgtgaccgacgagacgaataccaaggcg
gagaaggcggcctacctgaaggccgtgttcgaggcgctgtcggagttgatcggcaacgtg
catccggtttcgtatatccacgtgatcgatgcgcgcgcggcggcgtacgggtatggcggg
ctgacgcaggagtatcggcatcagcatgggtga

KEGG   Cupriavidus pinatubonensis JMP134: Reut_B5693
Entry
Reut_B5693        CDS       T00268                                 
Name
(GenBank) 4-oxalocrotonate isomerase
  KO
K01821  4-oxalocrotonate tautomerase [EC:5.3.2.6]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00362  Benzoate degradation
reu00621  Dioxin degradation
reu00622  Xylene degradation
reu01100  Metabolic pathways
reu01120  Microbial metabolism in diverse environments
reu01220  Degradation of aromatic compounds
Module
reu_M00569  Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Reut_B5693
   00622 Xylene degradation
    Reut_B5693
   00621 Dioxin degradation
    Reut_B5693
Enzymes [BR:reu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.2  Interconverting keto- and enol-groups
    5.3.2.6  2-hydroxymuconate tautomerase
     Reut_B5693
SSDB
Motif
Pfam: Tautomerase Tautomerase_2 Tautomerase_3
Other DBs
NCBI-ProteinID: AAZ65038
UniProt: Q46P96
LinkDB
Position
2:2523558..2523749
AA seq 63 aa
MPFAQIYMIEGRTVEQKRAVIQKVTSALVEATGAPKENVRVWIHDVPKENWGIAGESAKD
LGR
NT seq 192 nt   +upstreamnt  +downstreamnt
atgccgtttgcgcagatctacatgattgaaggccgcacggtggaacagaagcgtgccgtt
atacagaaagtcacttctgccttggtggaggcgacgggagcgccaaaggaaaatgtacgc
gtctggatccacgatgtaccaaaggaaaactggggaattgccggcgagtcggctaaagac
cttgggcgctag

DBGET integrated database retrieval system