KEGG   Cupriavidus pinatubonensis JMP134: Reut_A0875
Entry
Reut_A0875        CDS       T00268                                 
Name
(GenBank) Twin-arginine translocation pathway signal
  KO
K01061  carboxymethylenebutenolidase [EC:3.1.1.45]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00361  Chlorocyclohexane and chlorobenzene degradation
reu00364  Fluorobenzoate degradation
reu00623  Toluene degradation
reu01100  Metabolic pathways
reu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00364 Fluorobenzoate degradation
    Reut_A0875
   00361 Chlorocyclohexane and chlorobenzene degradation
    Reut_A0875
   00623 Toluene degradation
    Reut_A0875
Enzymes [BR:reu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.45  carboxymethylenebutenolidase
     Reut_A0875
SSDB
Motif
Pfam: DLH Peptidase_S9 Abhydrolase_1 Chlorophyllase TAT_signal Abhydrolase_5
Other DBs
NCBI-ProteinID: AAZ60254
UniProt: Q474C9
LinkDB
Position
1:952305..953180
AA seq 291 aa
MLKPEVESLVSGQTFNRRGFVKTALGSAFAAAALPAMAQAIKTDFAGLTAGEVTIPSGGF
SMPAYRAQPEGKTKLPVVLVVSEIFGVHEHIADVCRRFAKLGYLAIAPELFARQGDPQSF
GTIQELQTNVIAKVPDGQVMGDLDAAVAWAGANGGDLSKLAITGFCWGGRITWLYAAHNE
RLKAGVAWYGQLAGTPTPLKPKNPLDLVDQLDAPVLGLYGGKDTGITQEQVEKMKAALSA
SPDPDAKASKFVVYPESGHAFHADYRPSYREADAKDGWKKCLDWLRQHGVV
NT seq 876 nt   +upstreamnt  +downstreamnt
atgctgaaacccgaagtggaaagcctggtatccgggcagactttcaatcggcgcggtttc
gtcaagacagcactgggctccgcgttcgccgcggctgcgctgccggcgatggcgcaggcg
atcaagaccgacttcgcgggcctgaccgccggcgaagtgacgattccttcgggcggcttc
agcatgccggcctaccgcgcgcagcccgagggcaagacgaagttgccggtggtgctggtg
gtcagcgagatcttcggcgtgcacgagcacatcgccgatgtttgccgccgctttgccaag
cttggctacctggccattgcgccggagctgtttgcgcggcagggtgatccgcagagcttc
ggcaccatccaggaactgcagaccaacgtcatcgccaaggtgccggacgggcaggtcatg
ggtgatctcgacgcggccgtggcctgggccggcgccaatggtggcgacctgtcgaagctg
gcgatcacggggttctgctggggcgggcgcatcacgtggctgtatgccgcgcacaatgag
cggctgaaggccggcgtggcctggtacgggcagctcgccggcacgcctacgccgctgaag
ccgaagaacccgctggacctggttgaccagttggacgcgccggtgctcggcctctatggc
ggcaaggacacgggcatcacgcaagagcaggtcgagaagatgaaggcggcgctgtcggcg
tccccggatccggacgcaaaggcatcgaagttcgtcgtctatcccgaatccggccacgct
ttccacgccgattaccggccgagctatcgcgaggcggacgccaaggacggctggaagaag
tgcctcgactggctgcgccagcacggcgtcgtctaa

KEGG   Cupriavidus pinatubonensis JMP134: Reut_A3180
Entry
Reut_A3180        CDS       T00268                                 
Name
(GenBank) Carboxymethylenebutenolidase
  KO
K01061  carboxymethylenebutenolidase [EC:3.1.1.45]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00361  Chlorocyclohexane and chlorobenzene degradation
reu00364  Fluorobenzoate degradation
reu00623  Toluene degradation
reu01100  Metabolic pathways
reu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00364 Fluorobenzoate degradation
    Reut_A3180
   00361 Chlorocyclohexane and chlorobenzene degradation
    Reut_A3180
   00623 Toluene degradation
    Reut_A3180
Enzymes [BR:reu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.45  carboxymethylenebutenolidase
     Reut_A3180
SSDB
Motif
Pfam: DLH SnoaL_2 SnoaL Hydrolase_4 BAAT_C Erythro-docking
Other DBs
NCBI-ProteinID: AAZ62540
UniProt: Q46WE3
LinkDB
Position
1:complement(3479599..3480900)
AA seq 433 aa
MQAAAEALAAAVPTEPMELKGATGMGQTIQIQTQDGSFSGYLAIPAAGKGPGIVLCQEIF
GVNATMRQVADYYAEEGYTVLVPDLFWRIAPGIELTDRGEDFQRALGLYQQFDEDKGVQD
VGAALDALRARPECVGQTGVLGFCLGGKLAYLAACRLPGVACAVGYYGVGIERALDEADN
IRGRLVLHIAERDGFCSPEAQAQIREALGGRPSIELYVYPGMDHAFARVGGEHFDKASAL
MAHQRSIAAYRSEMGPHYDFSALWDKHCEHEFATRDVDATMATMVPEPYVNHIPTMTGGV
GYRQLKRFYQHHFVHSNPPDTTLIPLSRTIGASQVVDEMLFCFTHTCEIDWMLPGVPPTG
KRVEIPLIAIVKFRGDKLYHEHIYWDQASVLVQIGKLDPKGLPVAGVETARKLLEETQPS
NTLMARWSESERQ
NT seq 1302 nt   +upstreamnt  +downstreamnt
atgcaggcagcagcggaagcgctcgctgcggcagtccccacagaacctatggaacttaaa
ggagcgacaggcatgggccagactatccagatccagacccaggacggcagtttcagcggt
tatctcgccatcccggcggcaggcaagggccccggcatcgtgttatgccaggagatcttc
ggggtcaatgccacgatgcggcaagtagcggactactacgccgaggaaggctacacggtg
ctggtgccggacttgttctggcgtattgcgcccggaatcgagctgacggaccgaggcgag
gacttccagcgggcgctagggctatatcagcagttcgacgaggacaagggcgtgcaggat
gtgggcgccgcgctcgatgcactgcgcgcacggccagaatgcgtcggccagaccggtgtg
cttggcttctgcctgggtggcaagctggcctacctggcggcgtgccggttgcccggcgtg
gcttgtgccgtcggctactatggcgtcggcatcgaacgggcgctggacgaggcggacaat
atccgaggacggctcgtgctgcatattgccgaacgagatggcttttgctcacccgaagcg
caggcgcagattcgtgaagcgctgggcggccggcccagcatcgaactgtacgtctatcct
ggcatggaccacgccttcgcgcgcgttggcggcgagcacttcgacaaggcgtcggcactg
atggcgcaccagcgctccatcgcggcgtaccgcagcgagatgggcccgcactacgacttc
tccgcgctatgggacaagcactgcgagcacgaattcgccacgcgcgatgtggatgccacc
atggcaacgatggtgcccgagccctacgtcaaccacatcccgacgatgaccggaggcgtg
ggctaccgccagctcaagcgcttctaccagcaccacttcgtccacagcaatccgcctgac
accacgctgatcccgctgtcgcgcacgatcggcgcgagccaggtggtcgacgagatgctg
ttctgcttcacccatacttgcgagatcgactggatgctgcccggcgtgccgccgaccggc
aagcgcgtggagatcccgctgatcgcgattgtcaagttccgcggggacaagctctaccac
gagcacatctactgggatcaggccagcgtgctcgtgcagatcggcaagctcgaccccaag
ggtttgccggtggcaggcgtggagaccgcgcgcaagctgctggaagaaacacagccgtct
aacacgctgatggcgcggtggagcgagagcgagcgccagtga

KEGG   Cupriavidus pinatubonensis JMP134: Reut_B5577
Entry
Reut_B5577        CDS       T00268                                 
Name
(GenBank) Carboxymethylenebutenolidase
  KO
K01061  carboxymethylenebutenolidase [EC:3.1.1.45]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00361  Chlorocyclohexane and chlorobenzene degradation
reu00364  Fluorobenzoate degradation
reu00623  Toluene degradation
reu01100  Metabolic pathways
reu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00364 Fluorobenzoate degradation
    Reut_B5577
   00361 Chlorocyclohexane and chlorobenzene degradation
    Reut_B5577
   00623 Toluene degradation
    Reut_B5577
Enzymes [BR:reu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.45  carboxymethylenebutenolidase
     Reut_B5577
SSDB
Motif
Pfam: DLH Abhydrolase_6 Abhydrolase_8 Abhydrolase_1
Other DBs
NCBI-ProteinID: AAZ64922
UniProt: Q46PL2
LinkDB
Position
2:complement(2394764..2395477)
AA seq 237 aa
MPATPNSKWIRVDSDAGSFDAYLSLPPAGVQPDGPAIVLLQEIFGVNEHIRAVADQYAAD
GYTVLAPDVFWRDAPRIELGYAGPDMERAMALRKSVDVEAAVRDIAATVRTLRTHTGAGS
KVAAVGYCFGGLLAYLSAARGLVNAAVPYYGGGIQNNLQEASALNVPVQFHYGALDAHIT
PDAVANVRAAVAGKRGTEVFVYDGADHGFNCWARASYHQHSAALAHGRALTFLAQTL
NT seq 714 nt   +upstreamnt  +downstreamnt
atgccagccactcccaacagcaaatggatccgtgtcgacagcgacgccggcagctttgac
gcctacctgagcctgccgcctgcaggcgtgcagcccgatggccccgccatcgtgctgctg
caggaaatcttcggcgtcaacgaacatatccgcgcggtagccgaccagtacgcggccgac
ggctacaccgtgctcgcgcccgatgtgttctggcgcgatgcgccgcgcatcgagctgggc
tatgccggccccgacatggagcgcgccatggcgctgcgcaagtcggtcgacgtggaagcc
gccgtgcgcgatatcgccgcgaccgtgcgcacgttgcgcacgcacaccggtgcaggcagc
aaggttgcggcggttggctattgctttggcggcctgctcgcctacctgagcgcggcgcgc
ggcctcgtcaacgccgcggtgccctactacggcggcggcatccagaacaacctgcaggaa
gcgagcgcgctgaacgtgccggtgcagttccactacggcgcgctcgacgcgcatatcacg
cccgatgcggtcgccaacgtgcgtgccgctgtcgccggcaagcgtggcaccgaggtgttc
gtctacgacggcgccgaccacggattcaactgctgggcccgcgcgagttaccaccagcac
agcgcagcgctggcgcacggccgcgcactgaccttcctcgcgcagacgctgtaa

KEGG   Cupriavidus pinatubonensis JMP134: Reut_B5771
Entry
Reut_B5771        CDS       T00268                                 
Name
(GenBank) Carboxymethylenebutenolidase
  KO
K01061  carboxymethylenebutenolidase [EC:3.1.1.45]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00361  Chlorocyclohexane and chlorobenzene degradation
reu00364  Fluorobenzoate degradation
reu00623  Toluene degradation
reu01100  Metabolic pathways
reu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00364 Fluorobenzoate degradation
    Reut_B5771
   00361 Chlorocyclohexane and chlorobenzene degradation
    Reut_B5771
   00623 Toluene degradation
    Reut_B5771
Enzymes [BR:reu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.45  carboxymethylenebutenolidase
     Reut_B5771
SSDB
Motif
Pfam: DLH Hydrolase_4 Phage_TAC_6 Abhydrolase_1 Abhydrolase_11 FSH1 BAAT_C Abhydrolase_4
Other DBs
NCBI-ProteinID: AAZ65114
UniProt: Q46P20
LinkDB
Position
2:complement(2596344..2597090)
AA seq 248 aa
MKESIDDKTTIRTSWIDIPAADGRAYQGYLALPPARTGPGIVLFQEIFGVNRHIRAVAEQ
YAQLGFVVLAPDVFWRQAPRESFGYVGDEAARARDMLIRADMAEIESDLEGTVRSLRERP
EVTGGVGALGFCIGGRLAYLAAAAGLVDTAACYYGGGIQDQLQKASAVRCPMLFHYGETD
PMIPVAAVERVKAAFADRDTAKFFVYPGASHGFNCWERASYQPLAAMQAHGRTVLHFARH
LAAAPTVA
NT seq 747 nt   +upstreamnt  +downstreamnt
atgaaggaaagcatcgacgacaagacgacgatccgcacgagctggatcgacatccccgca
gccgatggtcgcgcgtaccaaggctatctcgcgctgccgccagcgagaacgggccccggg
attgtcctcttccaggaaatcttcggcgtgaaccgccatatccgggccgtagccgagcag
tacgcgcaactgggctttgtcgtgctcgcgcccgacgtgttctggcggcaggcgccgcgc
gaatcgttcggctatgtgggcgatgaagccgctcgcgcgcgtgacatgctcattcgcgcc
gacatggcagagatcgagagcgacctggaaggcaccgtgcgatcgctgcgcgagcgtccc
gaagtgacgggcggcgtgggggcgctcggcttctgcatcggtggccgcctggcctatctg
gccgccgctgcgggactggtggacaccgccgcgtgctactacggcggcggcattcaggac
cagttacagaaggcgtcggctgtgcgttgcccgatgctgttccactacggcgagaccgat
cccatgatcccggtcgccgcagtcgagcgggtcaaggcagcctttgccgaccgcgacacg
gcgaaattcttcgtctatcccggcgcaagccacggcttcaactgctgggagcgtgccagt
tatcagccgctcgccgcgatgcaggcgcacggtcggacggtgctgcacttcgcccgccat
cttgccgcagcccccacggtcgcatag

KEGG   Cupriavidus pinatubonensis JMP134: Reut_C6316
Entry
Reut_C6316        CDS       T00268                                 
Name
(GenBank) Carboxymethylenebutenolidase
  KO
K01061  carboxymethylenebutenolidase [EC:3.1.1.45]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00361  Chlorocyclohexane and chlorobenzene degradation
reu00364  Fluorobenzoate degradation
reu00623  Toluene degradation
reu01100  Metabolic pathways
reu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00364 Fluorobenzoate degradation
    Reut_C6316
   00361 Chlorocyclohexane and chlorobenzene degradation
    Reut_C6316
   00623 Toluene degradation
    Reut_C6316
Enzymes [BR:reu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.45  carboxymethylenebutenolidase
     Reut_C6316
SSDB
Motif
Pfam: DLH Abhydrolase_6 TetR_C_15
Other DBs
NCBI-ProteinID: AAZ65619
UniProt: Q46MK8
LinkDB
Position
mega:complement(489697..490419)
AA seq 240 aa
MQHSSIDVNIPIGDASMGGYLAVPATAPSGAIVVIQEIFGVTPAMRAIADDFASQGYIAL
VPDIYWRLQPNLDLGNGEDAEMRQLAVDYSIRYDEELGTQDLVAAADWLKSFLELTYQPA
VLGFCLGGRMAVRVAAAARFSCMVSMYGVGLEKMGDLIHAASCPVQFHFGENDNHNPLTT
IDAVRDATRTRGRTSDEFFTYPGAEHAFYNRFRLDRFNEAAHQLARERIARFLAQHTPAA
NT seq 723 nt   +upstreamnt  +downstreamnt
atgcagcacagttccattgacgtcaatattccgatcggcgacgccagcatgggaggctac
ttggcggtgcccgccacagcgccgagcggagccatcgtcgttatccaagagatcttcggc
gtcaccccagcaatgcgagccatcgccgatgattttgcatctcagggatacattgccctg
gtgcccgacatctactggcgcttgcaacccaatctggatctcggcaacggcgaggatgcg
gaaatgcgccagctcgctgtcgactattcgatccgctacgacgaggaactcggcactcaa
gatctcgtcgccgcggcagattggctcaagagctttcttgagcttacttatcagccagcg
gtgctcggtttttgcctcggaggtcgaatggctgtgcgcgtcgccgcagccgccaggttc
tcttgcatggtttcgatgtacggcgtcggcctcgagaagatgggcgacctgatccatgcg
gcctcctgcccggtgcaatttcacttcggcgagaacgacaatcacaaccctctcaccacg
attgacgcggtgcgcgatgccactcgcacgagagggcggacgtccgatgagttcttcacc
taccccggtgcggagcacgcgttttacaaccgtttccgactggatcggttcaacgaggcg
gcacaccagctcgcccgagaacgtatcgcgcgattccttgctcagcacacgcccgcagcc
tga

KEGG   Cupriavidus pinatubonensis JMP134: Reut_C6385
Entry
Reut_C6385        CDS       T00268                                 
Name
(GenBank) Carboxymethylenebutenolidase
  KO
K01061  carboxymethylenebutenolidase [EC:3.1.1.45]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00361  Chlorocyclohexane and chlorobenzene degradation
reu00364  Fluorobenzoate degradation
reu00623  Toluene degradation
reu01100  Metabolic pathways
reu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00364 Fluorobenzoate degradation
    Reut_C6385
   00361 Chlorocyclohexane and chlorobenzene degradation
    Reut_C6385
   00623 Toluene degradation
    Reut_C6385
Enzymes [BR:reu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.45  carboxymethylenebutenolidase
     Reut_C6385
SSDB
Motif
Pfam: DLH
Other DBs
NCBI-ProteinID: AAZ65686
UniProt: Q46ME8
LinkDB
Position
mega:567236..567940
AA seq 234 aa
MRHIGQTVSFTRPDGQSVNGYLAKSDGTDGAPAIIVVQEWWGLNNQIRGVADRLARAGYT
ALVPDLYRGASTVEQQEAHHLMSKLNFGDAVAQDIRGAVQYLGTLSGSIGITGFCMGGAL
TLLSLNAIPELKAGVPFYGMPPLEAIDPANIKAAVLVHSATQDVFFAAEGFDKLEEKLRA
GGVDATFHRYLAHHAFANEDAIGDGRIAGTQYDAAWAQVAWDRTLTFFARHLWR
NT seq 705 nt   +upstreamnt  +downstreamnt
atgcgacacatcggtcaaaccgtctcattcacccgccccgacggccagtcggtcaacggt
taccttgccaagtcggatggcaccgacggtgcgccggccatcatcgtggtccaggagtgg
tgggggctgaacaaccagatccgcggcgtggctgaccgccttgcgcgcgccggctacacc
gcgctggtgcccgacctctaccgcggcgccagcacggtcgagcagcaagaggcccaccat
ctgatgtccaagctgaacttcggcgatgccgtggcgcaggacatccgcggcgccgtgcaa
tatctcggcaccctgagcggcagcatcggcatcaccggcttctgcatgggcggcgcactg
acgctgctgtcgctgaacgccatccccgagttgaaggcaggcgtgccgttctacggcatg
ccgccactggaggccatcgaccccgccaatatcaaggcggcggtgctggtccactcggca
acgcaggacgtgttcttcgcggccgagggcttcgacaagcttgaggagaagctgcgcgcc
ggcggcgtcgatgcgacgttccaccgctacctcgcgcaccatgcctttgccaacgaggac
gccatcggcgacggccgcatcgccggcacccagtacgacgccgcctgggcgcaggtggcc
tgggaccgcacgctgacgttcttcgcgcgtcacctctggcgctga

KEGG   Cupriavidus pinatubonensis JMP134: Reut_D6464
Entry
Reut_D6464        CDS       T00268                                 
Name
(GenBank) Carboxymethylenebutenolidase
  KO
K01061  carboxymethylenebutenolidase [EC:3.1.1.45]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00361  Chlorocyclohexane and chlorobenzene degradation
reu00364  Fluorobenzoate degradation
reu00623  Toluene degradation
reu01100  Metabolic pathways
reu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00364 Fluorobenzoate degradation
    Reut_D6464
   00361 Chlorocyclohexane and chlorobenzene degradation
    Reut_D6464
   00623 Toluene degradation
    Reut_D6464
Enzymes [BR:reu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.45  carboxymethylenebutenolidase
     Reut_D6464
SSDB
Motif
Pfam: DLH Abhydrolase_6 Thioesterase Abhydrolase_1 FSH1 LIDHydrolase
Other DBs
NCBI-ProteinID: AAZ65762
UniProt: P27136
LinkDB
Position
p1:complement(20890..21594)
AA seq 234 aa
MLSDGVEITSRSGGRFGAYLGKPTTDSAPIVVIAQEIFGITPFIRETVEWLVGAGFGCVC
PDLYWRQAPNIELDANVPSEREQALALFRDFDMEAGVNDLSCAIEYARALPFSNGRVAVV
GYCLGGALAFDVAARSLADCSIGYYGVGLEKKVSLVPAITRPAMFHMGTKDHYVTEEARS
ILEEHFGRNKNLSLHWYPVGHSFARSSSPNFDQAATTVANARTLELLAMLKDPS
NT seq 705 nt   +upstreamnt  +downstreamnt
atgttatcagacggcgttgagatcacgtcgcgctcgggtggtcgctttggtgcctacctc
ggaaagccgacgacggactccgcacccatcgtcgtgatcgcgcaggagattttcgggatc
acgcctttcataagagaaaccgtggaatggctcgttggtgcgggctttggttgcgtgtgt
ccggatctgtactggagacaggcgccgaatatcgagcttgatgcaaacgtaccatcggaa
cgggaacaggcgcttgcgttgtttcgcgactttgacatggaggcaggagtcaatgacctt
tcatgcgccattgaatacgctcgtgcgctccctttctcgaacggtcgtgtcgctgtagtc
gggtactgcctgggaggtgcgctggcgtttgatgtggcggcgcgatcattggccgattgc
tcaatcggctattacggcgtgggacttgaaaaaaaggtctcactggtgccagctattaca
cgaccggcgatgttccacatgggtaccaaagatcactatgtcacagaagaggcccgtagc
attctcgaagagcatttcggtcgaaacaaaaatctgagtctgcactggtatccagtgggg
cattcatttgcacggtcatccagcccaaatttcgatcaggcggcgacaactgtggccaat
gctcggacgctcgaactgcttgcaatgttgaaggacccttcatga

KEGG   Cupriavidus pinatubonensis JMP134: Reut_D6472
Entry
Reut_D6472        CDS       T00268                                 
Name
(GenBank) Carboxymethylenebutenolidase
  KO
K01061  carboxymethylenebutenolidase [EC:3.1.1.45]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00361  Chlorocyclohexane and chlorobenzene degradation
reu00364  Fluorobenzoate degradation
reu00623  Toluene degradation
reu01100  Metabolic pathways
reu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00364 Fluorobenzoate degradation
    Reut_D6472
   00361 Chlorocyclohexane and chlorobenzene degradation
    Reut_D6472
   00623 Toluene degradation
    Reut_D6472
Enzymes [BR:reu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.45  carboxymethylenebutenolidase
     Reut_D6472
SSDB
Motif
Pfam: DLH Abhydrolase_11 Thioesterase
Other DBs
NCBI-ProteinID: AAZ65770
UniProt: P94136
LinkDB
Position
p1:complement(29674..30381)
AA seq 235 aa
MCHDTAPALFPRTASTGSIDGAICALCYAGATRGPRLLVLPDIYGCNAFYRGYAAYLAEQ
GAGEVLLVDPFAAFGELATVTREAAFQRRHRLADRAYVEELIDFIDGQRIEGVVGFCLGG
LFVFELARQQVVSRLVAYYPFPQGLENRDPLDVPFDYLPALRSRHTVIVGDDDALLGTQN
LQRLQAQARANDAIDLHIMNGAGHGFLADLESPDTARAAVAKRGLRIGTTTLLGG
NT seq 708 nt   +upstreamnt  +downstreamnt
atgtgccacgacaccgcccccgcgttgttcccgcggaccgcatccacggggagcatcgac
ggtgcaatctgcgccttgtgctacgccggcgcgacaaggggaccgcgccttctcgtgctg
ccggacatctatggctgcaatgccttctaccgtggctatgccgcgtacctggcagagcaa
ggcgccggcgaggtgctcctggtcgatccctttgcggcgttcggcgaattggccacagtg
acgcgggaagcggccttccagcgacgtcaccgactggcggatcgtgcctacgtcgaggaa
ttgatcgacttcattgacggccagcgcatcgagggcgtggtcggcttctgtctcggtggc
ctcttcgtgttcgaactggcgcgacagcaggtcgtgtcgcggctcgtcgcttattacccg
tttccgcaggggctcgagaaccgcgacccgctggacgttccgttcgactatctgccggcg
cttcgttcgcggcatacggtcatcgtgggagacgacgatgcgctgctgggtacacagaac
ctgcagcggttgcaagcacaagcccgcgccaacgatgcgatcgacctgcacatcatgaac
ggtgccggccacggcttcctggcagatctcgaatcgccggacacggcgcgcgcggccgtg
gcgaagcgcggactgcgcatcggtacgacgaccttgttggggggctga

DBGET integrated database retrieval system