KEGG   Cupriavidus pinatubonensis JMP134: Reut_A1010
Entry
Reut_A1010        CDS       T00268                                 
Name
(GenBank) 3-hydroxyacyl-CoA dehydrogenase
  KO
K00074  3-hydroxybutyryl-CoA dehydrogenase [EC:1.1.1.157]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00360  Phenylalanine metabolism
reu00362  Benzoate degradation
reu00650  Butanoate metabolism
reu01100  Metabolic pathways
reu01120  Microbial metabolism in diverse environments
reu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Reut_A1010
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    Reut_A1010
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Reut_A1010
Enzymes [BR:reu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.157  3-hydroxybutyryl-CoA dehydrogenase
     Reut_A1010
SSDB
Motif
Pfam: 3HCDH_N 3HCDH 2-Hacid_dh_C NAD_binding_2 3HCDH_RFF F420_oxidored XdhC_C NAD_Gly3P_dh_N
Other DBs
NCBI-ProteinID: AAZ60389
UniProt: Q473P4
LinkDB
Position
1:complement(1098446..1099969)
AA seq 507 aa
MSTFTIETLGIVGTGAMGRGIAQIAAQAGLTVNLYDANPQAVEAARKYLQDTLGKLAEKG
KISAADADATLARVKPCGALEDLSRCDMVVEAIVERLDVKRDLVAKLEAVLRPDAIIASN
TSSLSITAIAVGAKEPGRVVGYHFFNPVPLMKVVEVIDGLSGNPAVGDALMALSRRMGHT
PVRCKDMPGFIVNHAGRGMNIEGIKVAQEGVAEFVDIDNIMREQAGFRMGPFELMDLTGL
DVSHPVMESIYNQFYQEPRYRPSPITAIRSVGGLVGRKAGAGFYRYVDGQKQVPAVAAVP
SARPASVWVSRASERGHAMVTKLLGAMGVTPESGEQPSADALIVVTPLGLDATTTALQQG
LDASRTVAIDTLLPFEATKRRTLMTTPATSAAARNAAHGLFASDGVPVTVIRDSAGFVAQ
RVLCCIINIASDIAQQRIASPADIDLAVNLGLGYPKGPLALGDAVGPQLVLETLRNMEAL
TGDMRYRPSPWLWRRAGLGLSLLTEEN
NT seq 1524 nt   +upstreamnt  +downstreamnt
atgagcactttcaccatcgagacgctcggcatcgtgggaacgggcgccatgggccgcggt
atcgcccagatcgcggcgcaggctggcctgaccgtcaacctgtacgacgccaacccgcaa
gccgtggaagccgcgcgcaagtatctgcaggatacgcttggcaagctcgctgaaaaaggc
aagatctcggcggccgatgccgatgccacgctggctcgcgtgaagccgtgcggcgcgctc
gaagacctgtcccgctgcgacatggtggtggaggcgatcgtcgagcggctcgacgtgaag
cgcgatctcgtcgccaagctggaggccgtgctgcgccccgacgcgatcatcgcgtcgaac
acctcgtcgctgtcgatcaccgcgattgcggtcggtgcgaaggaaccgggccgcgtcgtc
ggctaccacttcttcaatccggtgccgctgatgaaggtggtcgaggtcatcgacggcctg
tcgggcaatccggccgtgggcgatgcgctgatggcgctgtcgcgccgcatgggccatacg
ccggtgcgatgcaaggacatgccgggctttatcgtcaaccacgccggccgtggcatgaat
atcgaaggcatcaaggtcgcgcaggaaggggtggccgaatttgtcgatatcgacaacatc
atgcgcgagcaggccggcttccgcatggggccgttcgagctgatggacctgaccggactc
gatgtgtcgcacccggtcatggaatcgatctacaaccagttctaccaggagccgcgctac
cgcccgtcgccgatcacggcgatccgctcggtgggcgggctggtcgggcgcaaggcaggc
gccggtttctatcgctacgtggacggccagaagcaggtcccggccgttgccgccgtcccg
tcggcgcgtccggccagcgtgtgggtcagccgcgcgagcgagcgtggccatgcgatggtc
acgaagctgctcggcgcgatgggcgtgacgcccgagagcggtgaacagccatcagccgat
gcactgatcgtcgtcacgccgctgggcctcgacgccacgactaccgcgctccagcagggt
ctggatgcctcgcgcacggtggccatcgacacgctgctgccgttcgaagccaccaagcgc
cgcacgctgatgaccacacccgccacaagcgctgccgcacgcaacgccgcgcacggcctg
ttcgcgagcgacggcgtgccggtcacggtgatccgcgattcggccggcttcgtggcccag
cgcgtgctctgctgcatcatcaacatcgccagcgacatcgcgcagcagcgcattgcctcg
ccggccgacatcgacctggccgtgaacctcggcctcggctacccgaagggtccgctggcg
cttggagacgccgtcggcccgcaactggtgctggaaacgctgcgcaatatggaagccctg
accggcgacatgcgctaccgcccgagcccgtggctgtggcgccgtgccggtctcggcctg
tcgctgctgaccgaagagaactga

DBGET integrated database retrieval system