KEGG   Cupriavidus pinatubonensis JMP134: Reut_A1194
Entry
Reut_A1194        CDS       T00268                                 
Name
(GenBank) conserved hypothetical protein
  KO
K01647  citrate synthase [EC:2.3.3.1]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00020  Citrate cycle (TCA cycle)
reu00630  Glyoxylate and dicarboxylate metabolism
reu01100  Metabolic pathways
reu01110  Biosynthesis of secondary metabolites
reu01120  Microbial metabolism in diverse environments
reu01200  Carbon metabolism
reu01210  2-Oxocarboxylic acid metabolism
reu01230  Biosynthesis of amino acids
Module
reu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
reu_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
reu_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Reut_A1194
   00630 Glyoxylate and dicarboxylate metabolism
    Reut_A1194
Enzymes [BR:reu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.1  citrate (Si)-synthase
     Reut_A1194
SSDB
Motif
Pfam: Citrate_synt FtsK_4TM SLT_3
Other DBs
NCBI-ProteinID: AAZ60565
UniProt: Q472W8
LinkDB
Position
1:complement(1276564..1277367)
AA seq 267 aa
MSSTHTSIRTDIGTTTPDRISVRGRDLARDVIGKIDFVQMLCLVVLGRLPDEAEASMIDT
LLVTAVDHGLTPSAISTRMTWLGAPESLQGAVAAGLLGAGERFLGTVQNTAELLLREAAD
LAPDAKEPILQEIARRVVTTARQDGRALPGLGHPIHLNGDPRVPALFDTARANGFFGRHC
RLAVALAEASGKPGAGGSEKRKLPLNAAGALGAILADMGLDPLFGRGLALIGRCAGLVAH
VLEEREHPTAARMWELVLRQDTRNVLP
NT seq 804 nt   +upstreamnt  +downstreamnt
atgagcagcactcacacgagcatccgcactgacattggcaccaccacgccagaccgcatt
tcggtgcgtggccgcgatcttgcgcgcgacgtgattggcaagatcgattttgtgcagatg
ctgtgcctggtggtgctcggcaggctgccggacgaggctgaggcatccatgatcgacacg
ttacttgtgacagcggtggaccatggactgacccccagtgccatcagcacgcgcatgact
tggctgggcgctcccgagtcactgcagggcgccgtggcagccggcctgcttggcgcaggt
gaacgttttctcggcacggtgcaaaacactgccgaactactcctgcgagaagctgctgat
ctggcaccggacgcaaaggagcccatattgcaagagatcgcacgccgggtcgtgacgact
gcgcgacaggacgggcgcgccctgcccggcctgggccatccgattcatttaaatggcgat
ccacgcgtgccggcgttgttcgatacagcgagggctaacggattcttcggccggcactgc
cgtttggctgtcgccctcgccgaggcgtcaggcaagccaggcgctggtggaagcgagaag
cgcaagctcccgctcaatgcagccggtgccctcggcgccatcctggctgacatggggctg
gatcccctgtttggccgcggccttgcgctgattggccgatgtgcaggcctggtcgcccat
gttctggaagaacgcgagcatccgaccgctgcgcgcatgtgggagcttgtactgcgccaa
gacacgcgcaacgtgctgccctaa

KEGG   Cupriavidus pinatubonensis JMP134: Reut_A1760
Entry
Reut_A1760        CDS       T00268                                 
Name
(GenBank) Citrate synthase
  KO
K01647  citrate synthase [EC:2.3.3.1]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00020  Citrate cycle (TCA cycle)
reu00630  Glyoxylate and dicarboxylate metabolism
reu01100  Metabolic pathways
reu01110  Biosynthesis of secondary metabolites
reu01120  Microbial metabolism in diverse environments
reu01200  Carbon metabolism
reu01210  2-Oxocarboxylic acid metabolism
reu01230  Biosynthesis of amino acids
Module
reu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
reu_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
reu_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Reut_A1760
   00630 Glyoxylate and dicarboxylate metabolism
    Reut_A1760
Enzymes [BR:reu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.1  citrate (Si)-synthase
     Reut_A1760
SSDB
Motif
Pfam: Citrate_synt HTH_17 MerR_1 MerR
Other DBs
NCBI-ProteinID: AAZ61125
UniProt: Q470Q8
LinkDB
Position
1:complement(1916636..1917760)
AA seq 374 aa
MDEACARLGVRPQTVYAYVSRGKIEVMSDPVDTRRSLYRAEDVATLAKRKQAGRKHETLA
TNTLFGAEPSIPTAISTFLRERLYYRGRDAVVLAETATLEEAAQLLWDSAQPVNFSSSTK
VAKPGRVAAFKALAELAATGHSTHGRMTRVLHAEGQGLVGQMANAFGAQPGQQALHMRFA
QGWGLKPAGAELLRMAMVLLVDHELTSSAFASRIAASNGASLPACLLSGLATLSGPLHGD
ASGRVKALFNDVERQGEDQVITHYLSTGQALAGFGHHLYPEGDPRAAALLSRFEPPPVIA
RFIAQATRLTGLQPNIDVALAALVIHCGLPDDAAFGMFATARSIGLLAHSLEQLGVGQVI
RPRGRYVGVVPERV
NT seq 1125 nt   +upstreamnt  +downstreamnt
atggacgaggcatgcgcgcggctcggcgtgaggccgcagacggtctacgcgtacgtcagc
cgcggcaagatcgaggtcatgtccgatccggtcgatacgcgtcgcagcctgtatcgcgcc
gaagacgtggcgacgctggccaaacgcaagcaggctggccgcaagcatgagacgctggcc
accaacacgctgtttggcgccgagcccagcattccgaccgcgatctcaacgttcctgcgc
gaacggctctactaccgtggccgcgacgcggtggtgctcgccgaaaccgccacgctggaa
gaggccgcgcagttgctgtgggattcagcgcagcccgtgaatttttcgtcgtccaccaag
gtggcaaaaccggggcgtgtggcggccttcaaggcgttggccgaactggctgccaccggt
cattcgacacatggccgcatgacgcgcgtcctgcatgcggaaggccagggcctggtcggc
cagatggccaacgcgtttggcgcacagccggggcagcaagcgctgcatatgcgcttcgcg
caagggtgggggctgaagccggcaggggccgagttgctgaggatggccatggtgctgctg
gtcgatcatgaactgaccagctccgcgtttgcgtcgcgtatcgcggcgtcgaacggtgcg
tcgttgccggcgtgcctgctttccggcctcgctaccttgtccgggccgctgcacggtgat
gcttccggtcgcgtcaaggcgctgttcaacgacgtcgaacggcagggcgaagatcaggtc
atcacgcactacctgtcgacaggacaggcgcttgcgggcttcggacaccacctctatccc
gagggcgacccacgcgccgccgcgctgctgtcacggttcgagccaccgccggtcatcgcc
cggttcatcgcacaggcaacacgcctgaccggcttgcagcccaatatcgacgtggcattg
gccgcgctggtgattcactgcggcctgcccgacgatgcagcattcgggatgttcgccacg
gcgcgcagcatcggactgctcgcgcatagcctggagcaactgggtgtgggacaggtgatc
cgtccgagaggccgctatgtcggcgtggtgccggaacgggtctga

KEGG   Cupriavidus pinatubonensis JMP134: Reut_A2320
Entry
Reut_A2320        CDS       T00268                                 
Name
(GenBank) citrate synthase
  KO
K01647  citrate synthase [EC:2.3.3.1]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00020  Citrate cycle (TCA cycle)
reu00630  Glyoxylate and dicarboxylate metabolism
reu01100  Metabolic pathways
reu01110  Biosynthesis of secondary metabolites
reu01120  Microbial metabolism in diverse environments
reu01200  Carbon metabolism
reu01210  2-Oxocarboxylic acid metabolism
reu01230  Biosynthesis of amino acids
Module
reu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
reu_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
reu_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Reut_A2320
   00630 Glyoxylate and dicarboxylate metabolism
    Reut_A2320
Enzymes [BR:reu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.1  citrate (Si)-synthase
     Reut_A2320
SSDB
Motif
Pfam: Citrate_synt
Other DBs
NCBI-ProteinID: AAZ61682
UniProt: Q46YV1
LinkDB
Position
1:complement(2559414..2560715)
AA seq 433 aa
MTPSDVKATLSFSDGSPSVELPIYKGTVGPDVIDIRKLYGQTGKFTYDPGFMSTASCNSK
ITYIDGDKGELLYRGYPIEQLAQKCDHLETCYLLLKGELPNAKQKEEFTGHVMNHTMVHE
QLQFFLRGFRRDAHPMAVLTGLVGAMSAFYHDAMDIDDPHQREISAIRLIAKMPTMVAMA
YKYNIGQPYIYPQNDLSYSGNFLRMLFGTPCAPYTVNPVLERALDRIFILHADHEQNAST
STVRLAGSSGTNPFAAIAAGVACLWGPAHGGANEAALKMLEEIGSVDNIGEFIKQVKDKN
SGVRLMGFGHRVYKNYDPRAKLMRETCHEVLNELGLHNDPLFKLAMELEKIALEDEYFVS
RKLYPNVDFYSGIVQRALGIPTSLFTCIFALARTPGWISQWEEMITDPEYKIGRPRQLFN
GAASRDVPDISKR
NT seq 1302 nt   +upstreamnt  +downstreamnt
atgacgccgtccgatgtgaaagccacgctatcgttctccgatggttcccccagcgttgag
ctgccgatctacaagggcaccgtaggcccggacgtgatcgacattcgcaagctgtacggc
cagaccggcaagttcacctacgaccccggtttcatgtcgacggcttcgtgcaattcgaag
atcacctacatcgacggcgacaagggcgagctgctgtaccgcggctacccgatcgagcaa
ctggcgcagaagtgcgaccacctcgaaacctgctacctgttgctgaagggcgaactgccc
aacgccaagcagaaggaagaattcaccggccacgtcatgaaccacaccatggttcacgag
cagctgcagttcttcctgcgcggtttccgccgcgatgcgcacccgatggccgtgctgacc
ggcctggtcggtgccatgagcgcgttctaccacgacgcgatggacatcgatgatccgcac
cagcgcgagatctcggccatccgcctgatcgccaagatgccgaccatggtcgccatggcg
tacaagtacaacatcggccagccgtacatctacccgcagaacgacctgtcctactcgggc
aacttcctgcgcatgctgttcggcacgccgtgcgccccgtacaccgtgaacccggtgctg
gagcgtgcgctggaccgaatcttcatcctgcacgccgaccacgagcagaacgcttcgacc
tcgaccgtgcgtctggccggttcgtcgggtacgaaccccttcgcagcgatcgccgctggc
gtggcctgcctgtggggtccggctcacggcggcgccaacgaagccgcgctgaagatgctg
gaagagatcggcagcgtcgacaacatcggcgagttcatcaagcaggtcaaggacaagaac
tcgggcgtgcgcctgatgggctttggccaccgcgtgtacaagaactacgatccgcgcgcc
aagctgatgcgcgaaacctgccatgaagtgctgaacgaactgggcctgcacaacgacccg
ctgttcaagctcgccatggagctggaaaagatcgcgctggaagacgaatacttcgtcagc
cgcaagctgtacccgaacgtcgacttctactcgggcatcgtccagcgcgcgctgggtatc
ccgacgtcgctgttcacctgcatcttcgcgctggctcgtaccccgggctggatctcgcag
tgggaagagatgatcaccgatccggaatacaagatcggccgtccgcgccagctgttcaac
ggcgccgcttcgcgcgacgtgccggacatttccaagcgctaa

KEGG   Cupriavidus pinatubonensis JMP134: Reut_B3867
Entry
Reut_B3867        CDS       T00268                                 
Name
(GenBank) citrate synthase
  KO
K01647  citrate synthase [EC:2.3.3.1]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00020  Citrate cycle (TCA cycle)
reu00630  Glyoxylate and dicarboxylate metabolism
reu01100  Metabolic pathways
reu01110  Biosynthesis of secondary metabolites
reu01120  Microbial metabolism in diverse environments
reu01200  Carbon metabolism
reu01210  2-Oxocarboxylic acid metabolism
reu01230  Biosynthesis of amino acids
Module
reu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
reu_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
reu_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Reut_B3867
   00630 Glyoxylate and dicarboxylate metabolism
    Reut_B3867
Enzymes [BR:reu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.1  citrate (Si)-synthase
     Reut_B3867
SSDB
Motif
Pfam: Citrate_synt
Other DBs
NCBI-ProteinID: AAZ63225
UniProt: Q46UF9
LinkDB
Position
2:complement(485031..485810)
AA seq 259 aa
MVTTVKTEIGYTTTDTIMVRGLNLATEIIGKFDFVDMIFFTTLSRLPTPREKVMVNALLV
TTADHGITPSSLSARLTYIGAPEALQGAVATGLLGAGSVFLGPMQNATEMLNEGTRELSD
DATDEQLLETARALIKRYKESRQQVYGVGHPIHVDGDPRVPALRELSRQNGYYGLHWRLM
EAIVEVLVKEQKRKLPMNVVGAIGAIVAAMGLDPLIARGLALVGRSAGLLAHVLEEKQDP
MAREAWQLVLKADPRNVLP
NT seq 780 nt   +upstreamnt  +downstreamnt
atggtaacgactgtcaagactgaaatcggctacaccaccaccgacacgatcatggtgcgt
ggcctgaacctcgccacggagatcatcggcaagttcgattttgtcgacatgatcttcttc
accacgctgtcgcgcctgcccacgccgcgcgagaaggtcatggtcaacgccttgctggtg
accacggccgaccacggcatcacgccgagttcgctgtcggcccgcctgacctacatcggc
gcgccggaagcgctgcagggcgcggtggccaccggcctgctcggcgcgggcagcgtattc
ctcggcccgatgcagaatgcgaccgagatgctcaacgaaggcacgcgcgaactcagcgat
gacgccaccgacgagcagctgctggaaaccgcccgcgcgctgatcaagcgctacaaggaa
agccgccagcaggtctacggcgtgggccatccgatccacgtcgatggcgacccgcgcgtg
ccggcgctgcgcgagctgtcgcgccagaacggctactacggcctgcactggcgcctgatg
gaggcgatcgtcgaggtgctggtcaaagagcaaaagcgcaagctgccgatgaacgtggtc
ggcgcgatcggcgccatcgtcgccgcgatgggcctggacccgctgatcgcgcgcggcctg
gcgctggtgggccgctcggcaggcctgctcgcccacgtactcgaggaaaagcaggatccg
atggcgcgcgaagcgtggcagctcgtcctgaaggcagatccgcgcaacgtgctgccctga

KEGG   Cupriavidus pinatubonensis JMP134: Reut_B4697
Entry
Reut_B4697        CDS       T00268                                 
Name
(GenBank) conserved hypothetical protein
  KO
K01647  citrate synthase [EC:2.3.3.1]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00020  Citrate cycle (TCA cycle)
reu00630  Glyoxylate and dicarboxylate metabolism
reu01100  Metabolic pathways
reu01110  Biosynthesis of secondary metabolites
reu01120  Microbial metabolism in diverse environments
reu01200  Carbon metabolism
reu01210  2-Oxocarboxylic acid metabolism
reu01230  Biosynthesis of amino acids
Module
reu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
reu_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
reu_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Reut_B4697
   00630 Glyoxylate and dicarboxylate metabolism
    Reut_B4697
Enzymes [BR:reu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.1  citrate (Si)-synthase
     Reut_B4697
SSDB
Motif
Pfam: Citrate_synt
Other DBs
NCBI-ProteinID: AAZ64046
UniProt: Q46S38
LinkDB
Position
2:complement(1395679..1396458)
AA seq 259 aa
MANTNAKAAPGTKLCHYTEHAVYYGEDDLVVDLLGRASFVDVFMKQTFGRAPSPAEGQIV
EAVLVTLMEHGMTPSAIASRMIYASSPENLQAGVAAGLLAVASQFVGTMEPAAALLDRIV
AAGTDGLAEAKRIASEFRAGRRAVPGFGHHLHRPDDPRAIALLDLARELGTYGQRCAALA
WLAAEVDEAAGRHITINATGAIAAILGDIGIPAALMRGFAVLSRAAGLIAHIAEEQRDPS
GRFIWSLVDDAMTGALSPT
NT seq 780 nt   +upstreamnt  +downstreamnt
atggccaataccaacgcgaaagccgcacccggcacgaagctgtgccactacacggagcac
gcggtctactacggcgaagacgatctggtagtagatctgctcggccgcgccagctttgtc
gatgtcttcatgaagcagacgttcggcagggcgccgtcgccggcggaggggcaaatcgtc
gaagccgtgctggtcaccctcatggaacatggcatgacgccaagcgcgattgcttcgcgc
atgatctacgcaagctcgccggagaacctgcaggccggcgtcgcggccggcctgctcgcc
gttgccagccagtttgtcgggaccatggagccggccgctgccttgctcgaccgcatcgtg
gcggcgggcacagacgggcttgccgaagcgaaacgcattgcgagcgaatttcgcgccggc
cgccgcgcggtgccgggattcggccatcacctgcaccggccggacgatccgcgcgcgatc
gcgctgctggacctggcgcgcgaactcggcacgtatggtcaacgatgcgccgcgctggca
tggcttgccgccgaagtggacgaggctgcgggacgccacatcaccatcaatgccaccggc
gcgattgccgccatcctcggcgatatcggcattcccgcggcgctgatgcgcggttttgcc
gtgctgagccgggctgcaggactgatcgcgcatatcgccgaagaacagcgcgacccatcc
ggccgatttatctggagcctggtggatgacgccatgacgggcgcgctttcgcccacctga

KEGG   Cupriavidus pinatubonensis JMP134: Reut_B4959
Entry
Reut_B4959        CDS       T00268                                 
Name
(GenBank) citrate synthase
  KO
K01647  citrate synthase [EC:2.3.3.1]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00020  Citrate cycle (TCA cycle)
reu00630  Glyoxylate and dicarboxylate metabolism
reu01100  Metabolic pathways
reu01110  Biosynthesis of secondary metabolites
reu01120  Microbial metabolism in diverse environments
reu01200  Carbon metabolism
reu01210  2-Oxocarboxylic acid metabolism
reu01230  Biosynthesis of amino acids
Module
reu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
reu_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
reu_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Reut_B4959
   00630 Glyoxylate and dicarboxylate metabolism
    Reut_B4959
Enzymes [BR:reu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.1  citrate (Si)-synthase
     Reut_B4959
SSDB
Motif
Pfam: Citrate_synt
Other DBs
NCBI-ProteinID: AAZ64307
UniProt: Q46RC7
LinkDB
Position
2:1688000..1688848
AA seq 282 aa
MSEINQAMDPGQQLSQDWWRTEIIDMRPGEIRYRGYPIEQLIGQVSFAQMIWLMLRGELP
GPGQGELLDAALMAAVDHGPQAPSIAIARMAATCGVGLNNAMASAVNVLGDVHGGAGEQA
VELYQDIAGRIDEGAALDQAVSAGLAHYRDLHGRFVSGFGHRFHPVDPRAPRLLALVDQA
AEKSVVNGRFAAIARAVERALGEGRSKPVPMNIDGATAVIYAELGFPAPLARGLFCLSRS
VGILAHAWEQTQQGGRNKGPIPRQFLWTYDGTPQRDVPAQGD
NT seq 849 nt   +upstreamnt  +downstreamnt
atgagcgagatcaatcaggccatggaccccggccagcagctgtcccaggactggtggcgc
acggaaatcatcgacatgcgccccggcgaaatccgataccgcggctatccgatcgaacag
ctgatcggccaggtgtcgttcgcgcagatgatctggctgatgctgcgcggcgagctgccc
ggcccgggacagggcgaactgctcgatgccgcattgatggcggctgtcgatcacggcccg
caggcgcccagcatcgccatcgcgcgcatggccgccacttgcggcgtcggcctgaacaac
gcgatggcttcggccgtcaacgtgctcggtgatgtgcacggcggcgcaggcgagcaggct
gtggagttgtaccaggacatcgccgggcgcatcgacgaaggcgccgctctggaccaggcc
gtcagcgccggcctggcgcactaccgcgacctgcacggcaggttcgtctcgggcttcggc
caccgctttcatcccgtggatccgcgtgcgccgcgactgctggcgctggtggatcaggcg
gcggagaaaagcgtggtcaatggccgctttgccgcgattgcgcgggccgtggagcgcgcg
ctcggcgaaggccgcagcaagccagtgccgatgaatatcgacggggccacggctgtcatc
tacgcggaactggggtttccggcgccgctggcgcgcgggctgttctgcctgtcgcgctcc
gtgggcatcctcgcgcacgcgtgggagcagacacagcaaggcggccgcaacaagggcccg
atcccgcgccagttcctttggacctacgacggcacgccgcaacgcgatgtgccagcgcag
ggagactga

KEGG   Cupriavidus pinatubonensis JMP134: Reut_C6294
Entry
Reut_C6294        CDS       T00268                                 
Name
(GenBank) citrate synthase
  KO
K01647  citrate synthase [EC:2.3.3.1]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00020  Citrate cycle (TCA cycle)
reu00630  Glyoxylate and dicarboxylate metabolism
reu01100  Metabolic pathways
reu01110  Biosynthesis of secondary metabolites
reu01120  Microbial metabolism in diverse environments
reu01200  Carbon metabolism
reu01210  2-Oxocarboxylic acid metabolism
reu01230  Biosynthesis of amino acids
Module
reu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
reu_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
reu_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Reut_C6294
   00630 Glyoxylate and dicarboxylate metabolism
    Reut_C6294
Enzymes [BR:reu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.1  citrate (Si)-synthase
     Reut_C6294
SSDB
Motif
Pfam: Citrate_synt
Other DBs
NCBI-ProteinID: AAZ65597
UniProt: Q46MN0
LinkDB
Position
mega:466489..467397
AA seq 302 aa
MPIWDSNTRTYDSPDQFEIHLDRFTPLTEMEHCMTNMTKTADRKYWRTAIGDPTPHEGTM
VRGYDVLTDLVGKIDFGAMVYLLYKGELPKGNESKIINAMFISVADHGISPSSTVTRFVQ
AAGVPIQCAVAAGAMMFGDVHGGAGEEFSRYIQELVSLAASSGRTYEDVATEHVANHKRL
DGFGHPQHPEGDPRGKVLFALAEEYGIAGDHVRMTRELEKALIKKKNRPLLANIDAAVGA
IISDMGFDWRLARAFIVVPRTAGLFAHAFEESVREPGWRQINLDQVEYDGPARRKNENPS
AI
NT seq 909 nt   +upstreamnt  +downstreamnt
atgccgatttgggattcaaacacccggacctacgattcccctgaccagttcgagatccat
ctcgatcgcttcacgcctctcactgaaatggagcactgcatgaccaacatgaccaagacc
gccgatcgcaaatactggcgcaccgccatcggtgaccccaccccccatgaaggcacgatg
gtcaggggttacgacgtcctcaccgatttggtgggcaagatcgacttcggcgccatggtg
tacctgctgtacaagggcgaactgcccaagggcaacgagtccaagatcatcaacgcgatg
ttcatctcggtcgctgaccacggcatttcaccgtcctcgacagtgacccgttttgtgcag
gcagccggcgtgccgatccagtgcgcggtcgcggccggtgccatgatgtttggcgatgta
cacggaggcgccggcgaagagttctcccgctacattcaggaactggtgtccttggccgcc
tcgagcggtcgcacctatgaggatgtagcgaccgagcacgtggccaaccacaagcggctg
gatggcttcggtcatccgcagcatcccgagggcgatcctcgcggcaaggtgctgttcgct
ctggctgaagagtatgggatcgcaggtgaccacgtccggatgactcgcgagctggaaaag
gcgctgatcaagaagaaaaaccgaccgctgctggcgaacatcgatgcggccgtgggcgca
atcatctcggacatgggcttcgactggcggctggctcgcgccttcatcgtcgttccccgc
acggccggtttgttcgcccacgcgttcgaggagtcggtgcgcgagccgggctggcgccag
atcaacctggaccaggtcgagtacgacggccctgcccgccgcaagaacgaaaaccccagc
gcgatctga

KEGG   Cupriavidus pinatubonensis JMP134: Reut_C6318
Entry
Reut_C6318        CDS       T00268                                 
Name
(GenBank) citrate synthase
  KO
K01647  citrate synthase [EC:2.3.3.1]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00020  Citrate cycle (TCA cycle)
reu00630  Glyoxylate and dicarboxylate metabolism
reu01100  Metabolic pathways
reu01110  Biosynthesis of secondary metabolites
reu01120  Microbial metabolism in diverse environments
reu01200  Carbon metabolism
reu01210  2-Oxocarboxylic acid metabolism
reu01230  Biosynthesis of amino acids
Module
reu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
reu_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
reu_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Reut_C6318
   00630 Glyoxylate and dicarboxylate metabolism
    Reut_C6318
Enzymes [BR:reu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.1  citrate (Si)-synthase
     Reut_C6318
SSDB
Motif
Pfam: Citrate_synt DUF1611
Other DBs
NCBI-ProteinID: AAZ65621
UniProt: Q46MK6
LinkDB
Position
mega:491739..492488
AA seq 249 aa
MSRTKIGSHLNDTTRLRMRGRDTLGEIIGTMTFTEGFYFIVTGREPTPAQARVLDAALLI
LMDHGLTPSAIVARLVADSNPEDIQIPLAAGALMVGNKFAGTMVGTGRILSEGMEFKGDK
KAWAVDVVRQYRESGRRIPGFGHPYYQPVDPRAERLFSVARDAGVEGTYIELLNTLHEAV
NAGAKRTITLNVTGALGAVLHEIGFPLEAMRAVAVVGRCAGLVAHVEEERKSPISQDIYT
FSESIEYDE
NT seq 750 nt   +upstreamnt  +downstreamnt
atgtctagaacgaagatcgggagtcatcttaatgacacgacgcgcttgcgtatgcgcggg
cgggataccttgggagagatcatcggaacgatgaccttcacggaaggcttttacttcatc
gtgacgggtcgtgaaccgactccagcacaggcccgcgtcctggatgccgctctactgatt
ttgatggatcacggcctcacgccaagtgcaatcgtcgcgcgactcgttgccgattcaaat
cccgaagatattcagatcccgctggcggccggagcgctaatggtaggcaataagtttgcc
ggcaccatggtcggtacgggtcgcatccttagcgaaggcatggagttcaagggtgacaag
aaggcatgggcggtggatgtggtgcgccagtatcgcgaatcggggcgccgcattcccggc
tttggtcatccgtactatcaaccggtggatccccgtgccgagcggctattttccgtggcg
cgagacgccggtgtcgagggcacgtatatcgagctcctgaatacgctgcatgaggccgtc
aatgccggtgcgaagcgtacgatcaccctgaacgtgacgggcgcacttggggcagtactt
cacgagatcggcttcccgcttgaggcgatgcgtgcggttgctgtggttggaaggtgcgcc
ggcctggttgcgcatgtcgaagaggaacggaagtctccgatttctcaagatatttatacg
ttcagcgaatccatcgaatacgacgagtga

KEGG   Cupriavidus pinatubonensis JMP134: Reut_C6352
Entry
Reut_C6352        CDS       T00268                                 
Name
(GenBank) citrate synthase
  KO
K01647  citrate synthase [EC:2.3.3.1]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00020  Citrate cycle (TCA cycle)
reu00630  Glyoxylate and dicarboxylate metabolism
reu01100  Metabolic pathways
reu01110  Biosynthesis of secondary metabolites
reu01120  Microbial metabolism in diverse environments
reu01200  Carbon metabolism
reu01210  2-Oxocarboxylic acid metabolism
reu01230  Biosynthesis of amino acids
Module
reu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
reu_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
reu_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Reut_C6352
   00630 Glyoxylate and dicarboxylate metabolism
    Reut_C6352
Enzymes [BR:reu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.1  citrate (Si)-synthase
     Reut_C6352
SSDB
Motif
Pfam: Citrate_synt
Other DBs
NCBI-ProteinID: AAZ65655
UniProt: Q46MH5
LinkDB
Position
mega:complement(526227..527528)
AA seq 433 aa
MTPSEVKATLSFSDGSPSVDLPIYQGTVGPDVIDIRKLYGQTGKFTYDPGFMSTASCNSK
ITYIDGDKGELLYRGYPIEHLAQKCDHLETCYLLLKGELPDATQKEEFVGRVMKHTMVHE
QLQFFLRGFRRDAHPMAVLTGLVGAMSAFYHDAMDIDDPHQREISAIRLIAKMPTLVAMA
YKYNIGQPYIYPQNDLSYSGNFLRMMFATPCAPYTVNPVLERALDRIFILHADHEQNAST
STVRLAGSSGTNPFAAIAAGVACLWGPAHGGANEAALKMLEEIGSVDNIGEFIKQVKDKN
SGVRLMGFGHRVYKNYDPRAKLMRETCHEVLNELGLHNDPLFKLAMELEKIALEDEYFVS
RKLYPNVDFYSGIVQRALGIPTSLFTCIFALARTPGWISQWEEMITDPEYKIGRPRQLFN
GAASRDQSEAAAS
NT seq 1302 nt   +upstreamnt  +downstreamnt
atgaccccgtccgaagtgaaagccacgctatcgttctccgatggttcccccagcgtcgac
ctgccgatctatcagggcaccgtaggcccggacgtgatcgacatccgcaagctgtacggc
cagaccggcaagttcacctacgaccccggtttcatgtcgacggcttcatgcaattcgaag
atcacctacatcgacggcgacaagggtgagttgctgtaccgcggctacccgatcgagcac
ctggcgcagaagtgcgaccacctcgaaacctgctacttgctgctgaagggcgaactgcct
gacgccacacagaaggaagagttcgtgggccgcgtgatgaagcacaccatggtgcatgag
caactgcagttcttcctgcgcggtttccgccgcgacgcccacccgatggccgtgctgacc
ggtctggtcggtgccatgagcgcgttctaccacgacgcaatggatatcgatgatccgcac
cagcgtgaaatctcggccatccgcctgatcgccaagatgccgaccctggtcgccatggcg
tacaagtacaacatcggccagccgtacatctatccgcagaacgacctgtcctattcgggt
aacttcctgcgcatgatgttcgccacgccgtgtgccccgtacaccgtgaacccggtgctc
gagcgcgcgctggaccgtatcttcatcctgcacgccgaccacgagcagaacgcttcgacc
tcgaccgtgcgcctggccggttcgtcgggtacgaacccgttcgcagcgatcgccgccggc
gtggcctgtctgtggggtccggcccacggcggcgccaacgaagccgcgctgaagatgctg
gaagagatcggcagcgtcgacaacatcggcgagttcatcaagcaggtcaaggacaagaac
tcgggcgtgcgcctgatgggctttggccaccgcgtgtacaagaactacgatccgcgtgcc
aagctgatgcgcgaaacttgccatgaagtgctgaacgaactgggcctgcacaacgacccg
ctgttcaagctcgccatggagctggaaaagatcgcgctggaagacgagtacttcgtcagc
cgcaagctgtacccgaacgtcgacttctactcgggcatcgtccagcgcgcgctgggcatc
ccgacgtcgctgttcacctgcatcttcgcgctggcccgcaccccgggctggatctcgcag
tgggaagagatgatcaccgatccggagtacaagatcggccgtccgcgccagctgttcaat
ggcgcggcttcgcgtgaccagtcggaagcggctgcatcctaa

DBGET integrated database retrieval system