KEGG   Cupriavidus pinatubonensis JMP134: Reut_A1323
Entry
Reut_A1323        CDS       T00268                                 
Name
(GenBank) benzoyl-CoA oxygenase, component A
  KO
K15511  benzoyl-CoA 2,3-epoxidase subunit A [EC:1.14.13.208]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00362  Benzoate degradation
reu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Reut_A1323
Enzymes [BR:reu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.208  benzoyl-CoA 2,3-epoxidase
     Reut_A1323
SSDB
Motif
Pfam: NAD_binding_1 Fer4 Fer4_21 Fer4_16 Fer4_7 Fer4_2 Fer4_9 Fer4_10 Fer4_6 FAD_binding_6 Fer4_4 Fer4_8 Fer4_17 FAD_binding_1 DUF1490 Fer4_11 Fer4_3
Other DBs
NCBI-ProteinID: AAZ60693
UniProt: Q472J0
LinkDB
Position
1:complement(1417262..1418515)
AA seq 417 aa
MGAPEMIKQHLIDPEICIRCNTCEDTCPIDAITHDERNYVVKADVCNACNACLSPCPTGA
IDNWRTMLKGQAYPIEEQLLWDELPAEIPLPAAELDAAGTDEALRADTATAAAEGGVTVQ
AVETSRHTSARAPWSAAHPYVNLHGVRAPMAATVAGNYRLTAEDASSDIHHIVLDFGTHF
FPVLEGQAIGIVPPGTDAAGKPHYIRMYSVASPRDGERPGYNNLALTVKRVEEDHDGNPV
RGVASNFLCDLAKGDTVQVVGPFGTTFLMPNHREASIMMICTGTGSAPMRAMTERMRRNM
EHFGGRRMLFFGARNARELPYFGPLLKLPKDFLDIHFAFSRDAEVPRRYVQDAIREASAG
VTALLSDPHGHVYICGLKGMEEGVLAAFGDVCAASGMSWPELEATMKAEGRLHIETY
NT seq 1254 nt   +upstreamnt  +downstreamnt
atgggcgcccccgaaatgatcaagcagcacctgatcgatccggaaatctgcattcgctgc
aatacctgcgaagacacgtgtccgatcgacgcgatcacccatgacgagcgcaactatgtg
gtgaaggccgacgtctgtaacgcgtgcaacgcctgcctctcgccatgcccgaccggcgcc
atcgacaactggcgcaccatgctcaagggccaggcctatccgatcgaagagcaactgctg
tgggatgaactgccggccgagataccgctgcctgcagcggaactcgatgcagccggcacg
gacgaagccctacgcgcagacaccgccacagctgccgcagaaggcggtgtaacggtacaa
gccgtggaaacgagccgacacacgtcggcgcgcgcgccatggtcggcagcccatccatat
gtcaacctgcacggcgtccgggcgcccatggcggctaccgtggctggcaactacaggctg
accgccgaggatgcatcaagcgacatccaccacatcgtgctggacttcggcacgcatttc
ttcccggtgctggaaggacaggccatcggcatcgtgccgcccggcacagacgcagccggc
aagccgcactacatccgcatgtactccgttgccagcccgcgcgacggcgaacggcctggc
tacaacaatcttgcgctgaccgtgaaacgcgtcgaggaagaccacgacggcaatccggtg
cgcggcgtggcgtcgaacttcctgtgcgacctggccaagggcgataccgtgcaggtggtc
gggccgttcggcactacgttcctaatgcccaatcaccgggaagccagcatcatgatgatc
tgcaccggcacgggctcggctcccatgcgcgcgatgaccgagcgcatgcggcgcaacatg
gagcacttcggtgggcgtcgcatgcttttcttcggtgcgcgcaatgctcgggagttgccg
tacttcggcccgctgctgaagctgccgaaagatttcctcgacatccatttcgcgttctcg
cgcgacgccgaggtgccacgccgctatgtgcaggacgcgatccgcgaggcgtcggccggc
gtgacggccctgctgtccgatccgcatggccatgtctacatctgcggcctgaaggggatg
gaagaaggcgtgctggcagccttcggcgatgtctgcgccgcgtcaggcatgtcgtggccg
gaactggaggccaccatgaaggccgaaggccggttgcatatcgagacttactga

KEGG   Cupriavidus pinatubonensis JMP134: Reut_A1324
Entry
Reut_A1324        CDS       T00268                                 
Name
(GenBank) benzoyl-CoA oxygenase, component B
  KO
K15512  benzoyl-CoA 2,3-epoxidase subunit B [EC:1.14.13.208]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00362  Benzoate degradation
reu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Reut_A1324
Enzymes [BR:reu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.208  benzoyl-CoA 2,3-epoxidase
     Reut_A1324
SSDB
Motif
Pfam: PaaA_PaaC
Other DBs
NCBI-ProteinID: AAZ60694
UniProt: Q472I9
LinkDB
Position
1:complement(1418591..1420015)
AA seq 474 aa
MSIDYSQKIPNNVNLADDRALQRALEHWQPAFLDWWRDMGPEGSHNFDVYLRTAVSVDPS
GWAHFEHVKMPDYRWGIFLQPADPARQIHFGEHKGEAAWQDVPGEHRANLRRIIVTQGDT
EPASVEQQRHLGLTAPSLYDLRNLFQVNVEEGRHLWAMVYLLHRYFGRDGREEAEALLDR
RSGDQDNPRILGAFNERTPDWLSFFMFTYFTDRDGKFQLCALAESGFDPLARTTRFMLTE
EAHHMFVGESGVSRVIQRTCEVMRERDIRDPADVRAAGVIDLETIQRYLNFHYSVTIDLF
GADQSSNAATFYSAGLKGRFEEGKRTDDHVLKSDVYRVLEVRDGQLGEREVPMLNALNEV
LRDDYIRDSIGGVARWNKVIEKHGIPFKLTVPHKAFNRKIGTLSNVHVSPTGELLTEAQW
QANERNWLATEEDRAYVASLMGRVTEPGKYANWIAPPAVGVNRQPMDFEYVRFN
NT seq 1425 nt   +upstreamnt  +downstreamnt
gtgagcatcgactacagccagaagatcccgaacaacgtcaacctggcggacgaccgcgcg
ctgcagcgcgcactggagcactggcagccggcgttcctggactggtggcgcgacatgggg
ccggagggctcgcacaactttgacgtgtacctgcgcacggctgtgtcggtcgacccgtcg
ggctgggcgcatttcgagcacgtaaagatgccggattaccgctggggcatcttcctgcag
cccgccgatccggcgcgccagatccatttcggcgagcacaagggcgaagccgcgtggcag
gacgtgccgggggaacatcgcgccaacctgcgtcgcatcatcgtcacgcagggcgataca
gagccggcatcggttgaacagcagcggcaccttggcctgactgcaccgagcctgtatgac
ctgcgcaacctgttccaggtgaacgtggaggaaggccgccatctgtgggccatggtgtat
ctgctgcaccgctatttcggccgcgacgggcgtgaggaagccgaggcgctgctcgatcgc
cgctccggcgatcaggacaatccgcgcatcctgggtgcattcaacgaacgcacgccggac
tggctgtcgttcttcatgttcacgtacttcaccgaccgcgacggcaagttccaactctgc
gcgcttgccgaatcaggcttcgatccgctcgcgcgcaccacgcgcttcatgctcaccgag
gaagcgcaccacatgttcgtcggcgaatcgggcgtgtcgcgcgtgatccagcggacttgt
gaagtaatgcgcgaacgtgacatccgtgacccggccgatgtgcgcgctgccggcgtgatc
gacctggagaccatccagcgctacctgaacttccactacagcgtcaccatcgacctgttc
ggcgcggaccagtcgtccaacgccgccacgttctacagcgccgggctcaagggccgcttc
gaggaaggcaagcgtaccgatgaccacgtgctcaagagcgacgtctatcgcgtgctcgaa
gtgcgcgacggccagctcggcgagcgtgaagtgccgatgctcaatgccctcaatgaagtg
ctgcgcgacgactacatccgcgattcgatcggcggcgtggcgcgctggaacaaggtgatc
gagaagcacggcatcccgttcaagctgacggtcccacacaaggcgttcaatcgcaagatt
ggcacgctttccaatgtgcacgtgtcgccgaccggcgagctgctgaccgaagcacagtgg
caagccaatgagcgcaactggctcgccacggaagaagaccgcgcctatgtcgcgtcgctg
atgggccgtgtgacggagcctggcaagtacgccaactggatcgcgccgcccgctgtcggc
gtcaatcgccagccaatggatttcgagtacgtgcgcttcaactga

DBGET integrated database retrieval system