KEGG   Cupriavidus pinatubonensis JMP134: Reut_A1584
Entry
Reut_A1584        CDS       T00268                                 
Name
(GenBank) Flavin reductase-like, FMN-binding protein
  KO
K15245  flavin reductase [EC:1.5.1.37]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00361  Chlorocyclohexane and chlorobenzene degradation
reu00740  Riboflavin metabolism
reu01100  Metabolic pathways
reu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    Reut_A1584
  09111 Xenobiotics biodegradation and metabolism
   00361 Chlorocyclohexane and chlorobenzene degradation
    Reut_A1584
Enzymes [BR:reu01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.37  FAD reductase (NADH)
     Reut_A1584
SSDB
Motif
Pfam: Flavin_Reduct
Other DBs
NCBI-ProteinID: AAZ60950
UniProt: Q471I3
LinkDB
Position
1:1707275..1707835
AA seq 186 aa
MSSAVFIEAGASRITDAAIDAIDATRFRDALSRAVTAVTVIATDGAGGRAGVTCSAVCSV
SDSPPTVLFCINRRSAANSVIKSNGVVSINWLHASQTAVSQLFAGAGAVPMAQRFDGDSW
GVFGTGAPYSKSAMVALDCKVVDQLEIGTHSVFVAQVLGSSGAESSNDTPLVYCRRSYAT
TQPVAA
NT seq 561 nt   +upstreamnt  +downstreamnt
atgtcgtccgcagtcttcatcgaagccggcgcgagccgcattaccgacgccgccatcgac
gccatcgacgccacgcgcttccgcgacgccttgtcgcgtgcagtcaccgccgtgaccgtc
atcgccaccgacggcgccggaggccgcgctggcgtcacgtgctcggctgtttgttccgtg
agcgattcgccgcccaccgtgctgttctgcatcaatcgccgcagcgccgcaaacagcgtg
atcaagtccaacggcgtcgtcagcatcaactggctgcacgccagccagaccgcggtgtcc
cagctgttcgccggtgccggcgcggtgccgatggcgcagcgcttcgacggtgacagctgg
ggtgtgttcggcaccggcgcgccatacagcaagtccgccatggtcgcgctcgactgcaag
gtcgttgaccagctcgagatcggcacgcacagcgtcttcgtcgcgcaggtgctcggcagc
tcgggcgcggaaagcagcaacgacacgccgctggtctactgccgccgcagctacgccacc
acgcagccagtcgccgcctag

DBGET integrated database retrieval system