KEGG   Cupriavidus pinatubonensis JMP134: Reut_A1584
Entry
Reut_A1584        CDS       T00268                                 
Name
(GenBank) Flavin reductase-like, FMN-binding protein
  KO
K15245  flavin reductase [EC:1.5.1.37]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00361  Chlorocyclohexane and chlorobenzene degradation
reu00740  Riboflavin metabolism
reu01100  Metabolic pathways
reu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    Reut_A1584
  09111 Xenobiotics biodegradation and metabolism
   00361 Chlorocyclohexane and chlorobenzene degradation
    Reut_A1584
Enzymes [BR:reu01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.37  FAD reductase (NADH)
     Reut_A1584
SSDB
Motif
Pfam: Flavin_Reduct
Other DBs
NCBI-ProteinID: AAZ60950
UniProt: Q471I3
LinkDB
Position
1:1707275..1707835
AA seq 186 aa
MSSAVFIEAGASRITDAAIDAIDATRFRDALSRAVTAVTVIATDGAGGRAGVTCSAVCSV
SDSPPTVLFCINRRSAANSVIKSNGVVSINWLHASQTAVSQLFAGAGAVPMAQRFDGDSW
GVFGTGAPYSKSAMVALDCKVVDQLEIGTHSVFVAQVLGSSGAESSNDTPLVYCRRSYAT
TQPVAA
NT seq 561 nt   +upstreamnt  +downstreamnt
atgtcgtccgcagtcttcatcgaagccggcgcgagccgcattaccgacgccgccatcgac
gccatcgacgccacgcgcttccgcgacgccttgtcgcgtgcagtcaccgccgtgaccgtc
atcgccaccgacggcgccggaggccgcgctggcgtcacgtgctcggctgtttgttccgtg
agcgattcgccgcccaccgtgctgttctgcatcaatcgccgcagcgccgcaaacagcgtg
atcaagtccaacggcgtcgtcagcatcaactggctgcacgccagccagaccgcggtgtcc
cagctgttcgccggtgccggcgcggtgccgatggcgcagcgcttcgacggtgacagctgg
ggtgtgttcggcaccggcgcgccatacagcaagtccgccatggtcgcgctcgactgcaag
gtcgttgaccagctcgagatcggcacgcacagcgtcttcgtcgcgcaggtgctcggcagc
tcgggcgcggaaagcagcaacgacacgccgctggtctactgccgccgcagctacgccacc
acgcagccagtcgccgcctag

KEGG   Cupriavidus pinatubonensis JMP134: Reut_A1585
Entry
Reut_A1585        CDS       T00268                                 
Name
(GenBank) 4-hydroxyphenylacetate 3-hydroxylase
  KO
K24293  3,5,6-trichloropyridin-2-ol/2,4,6-trichlorophenol monooxygenase [EC:1.14.14.172 1.14.14.173]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00361  Chlorocyclohexane and chlorobenzene degradation
reu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00361 Chlorocyclohexane and chlorobenzene degradation
    Reut_A1585
Enzymes [BR:reu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.172  3,5,6-trichloropyridin-2-ol monooxygenase
     Reut_A1585
    1.14.14.173  2,4,6-trichlorophenol monooxygenase
     Reut_A1585
SSDB
Motif
Pfam: HpaB_N HpaB Acyl-CoA_dh_M PX
Other DBs
NCBI-ProteinID: AAZ60951
UniProt: Q471I2
Structure
LinkDB
Position
1:1707954..1709507
AA seq 517 aa
MIRTGKQYLESLNDGRNVWVGNEKIDNVATHPKTRDYAQRHADFYDLHHRPDLQDVMTFV
DKDGERRTMQWFGHYDKEQLRRKRKYHETIMREMAGASFPRTPDVNNYVLQTYIDDPSPW
ETQTIGAEGKVKAKNIVDFVNFAKKHDLNCAPQFVDPQMDRSNPDAQQRSPGLRVIEKND
KGIVVSGVKAIGTGVAFADWIHIGVFFRPGIPGDQIIFAATPVNTPGVTIVCRESVVKED
PIEHPLASQGDELDGMTVFDNVFIPWSHVFHLGNPEHAKLYPQRVFDWLHYHALIRQSVR
AELMAGLAILITEHIGTNKIPAVQTRVAKLIGFHQAMLAHIVASEELGFHTPGGAYKPNI
LIYDFGRALYLENFSQMIYELVDLSGRSALIFASEDQWNDEALNGWFERMNNGPVGQPHD
RVKIGRVIRDLFLTDWGNRLFVFENFNGTPLQAIRMLTMQRAEFSAAGPYGTLARKVCGI
ELTEGHDSEYKATAGYAQALDSARHQEKLALSGTMTV
NT seq 1554 nt   +upstreamnt  +downstreamnt
atgattcgcactggcaagcagtacctggaatcgctgaacgacggccgcaacgtatgggtc
ggcaacgagaagatcgacaacgtcgcgacgcaccccaagacgcgggactacgcgcagcgt
cacgccgacttctacgacctgcaccatcgtcccgacctgcaggacgtaatgaccttcgtc
gacaaggatggcgagcgccgcaccatgcagtggttcggccactacgacaaggaacagctg
cgccgcaaacgcaagtatcacgagacgatcatgcgcgagatggccggcgcgtcgttcccg
cgcacgccggacgtcaacaactacgtgctgcagacctatatcgacgatccgtcgccgtgg
gaaacgcagaccatcggcgccgaaggcaaggtgaaggcgaagaacatcgtcgacttcgtc
aatttcgccaagaagcacgacctgaactgcgcgccgcagttcgtcgatccgcagatggat
cgctccaaccccgatgcccagcagcgttcgccggggctgcgcgtgatcgagaagaacgac
aagggcatcgtcgtgtcaggggtcaaggctatcggcactggcgtggcgtttgccgactgg
attcatatcggggtgttcttccgccccggtatcccgggcgaccagatcatcttcgcggcc
acgccggtcaacaccccgggcgtgaccatcgtctgccgcgagagcgtggtcaaggaagat
cccatcgaacaccctctggcctcgcagggcgatgagctggacggcatgacggtattcgac
aacgttttcatcccgtggtcgcacgtgttccatttgggcaatccggaacacgccaagctc
tacccgcagcgtgtgttcgactggctgcactatcacgcgctgattcgccagtcggtgcgc
gccgagctgatggctggcctggcgatcctgatcaccgagcatatcggcaccaacaagatc
cccgcggtgcagacgcgcgtggccaagctgatcggcttccaccaggccatgctcgcgcac
atcgtcgcgagcgaggaactgggcttccatacgccgggcggggcctacaagccgaacatc
ctgatctacgacttcggccgggcgctttacctcgaaaacttctcgcagatgatctacgag
ctggtcgatctctccgggcgcagtgcgctgatcttcgcgagcgaagaccaatggaacgac
gaggccctcaacggctggttcgaacgcatgaacaatggtcctgtgggccagccgcatgac
cgcgtgaagatcggccgtgtgatccgcgacctgttcctgaccgactggggcaaccgcctg
ttcgtcttcgagaacttcaacggcacgccgctgcaggccatccgcatgctgactatgcaa
cgcgccgagttttccgctgctggtccctacggcacgctggcgcgcaaggtctgcggcatc
gaactgaccgagggccacgacagcgaatacaaggccacggccggctacgcccaggctctg
gattccgcgcgtcatcaggaaaagcttgccctgagcggcacgatgactgtgtga

DBGET integrated database retrieval system