KEGG   Cupriavidus pinatubonensis JMP134: Reut_A1587
Entry
Reut_A1587        CDS       T00268                                 
Name
(GenBank) catechol 1,2-dioxygenase
  KO
K04098  hydroxyquinol 1,2-dioxygenase [EC:1.13.11.37]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00361  Chlorocyclohexane and chlorobenzene degradation
reu00362  Benzoate degradation
reu01100  Metabolic pathways
reu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Reut_A1587
   00361 Chlorocyclohexane and chlorobenzene degradation
    Reut_A1587
Enzymes [BR:reu01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.37  hydroxyquinol 1,2-dioxygenase
     Reut_A1587
SSDB
Motif
Pfam: Dioxygenase_C Dioxygenase_N CarboxypepD_reg
Other DBs
NCBI-ProteinID: AAZ60953
UniProt: Q471I0
LinkDB
Position
1:1710178..1711008
AA seq 276 aa
MQEYDQHNLTKAVIARLADTPNARTKQIMTSLVRHLHDFAREVRLTEAEWKQGIDYLTAT
GQMCDDKRQEFILLSDVLGLSMLTVAMNQEKPEGCTEPTVFGPFHVEGAPHYAHGADVAN
GAKGEPCMVYGRVTGVDGRPVAGAVVETWQADADGHYDVQYEGLEVAQGRGVLKSGEDGR
FHFRTIVAQAYPIPDDGPVGELLRATGRHPWRPAHLHFMIKAPGYETLVTHVFRRGDKYL
DSDAVFGVRTSLIGDWVRQTDGTYRLDFDFVLNPTL
NT seq 831 nt   +upstreamnt  +downstreamnt
atgcaagagtatgaccagcataacctgaccaaggccgtcattgcgcgcctggccgatacg
cccaatgcgcgcacgaagcagatcatgaccagcctggtgcggcacctgcacgacttcgcg
cgcgaggtcaggctgaccgaggccgaatggaagcagggcatcgactacctgaccgccacg
ggccagatgtgcgacgacaagcgccaggagttcatcctgctcagcgacgtgctcggcctg
tcgatgctgaccgtggccatgaaccaggagaagccggaaggctgcaccgagcccaccgtg
ttcggtcccttccacgtcgaaggcgcaccgcactacgcacatggcgccgatgtggccaac
ggcgccaaaggcgagccctgcatggtctatgggcgcgtcaccggcgtagacggccggccg
gttgccggtgccgtggtggaaacctggcaggcggatgctgatggccactatgacgtgcag
tacgaagggctcgaagtcgcccagggccgcggcgtgctgaagtcgggagaggatggccgc
ttccatttccgcaccatcgtcgcgcaggcctatccgattcctgacgatggcccggttggc
gaattgcttcgcgccaccggccgccatccgtggcggcccgcgcacctgcacttcatgatc
aaggcgcctggctatgagacgctggtcacgcacgtgttccggcgcggcgacaagtatctc
gactccgatgccgtgttcggcgtgcgcacgtcgctgatcggcgactgggtgcgccagacg
gacggcacttaccggctcgacttcgatttcgtgctcaatccaaccctctag

KEGG   Cupriavidus pinatubonensis JMP134: Reut_B4137
Entry
Reut_B4137        CDS       T00268                                 
Name
(GenBank) hydroxyquinol 1,2-dioxygenase
  KO
K04098  hydroxyquinol 1,2-dioxygenase [EC:1.13.11.37]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00361  Chlorocyclohexane and chlorobenzene degradation
reu00362  Benzoate degradation
reu01100  Metabolic pathways
reu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Reut_B4137
   00361 Chlorocyclohexane and chlorobenzene degradation
    Reut_B4137
Enzymes [BR:reu01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.37  hydroxyquinol 1,2-dioxygenase
     Reut_B4137
SSDB
Motif
Pfam: Dioxygenase_C Dioxygenase_N CarboxypepD_reg
Other DBs
NCBI-ProteinID: AAZ63491
UniProt: Q46TP3
LinkDB
Position
2:776546..777451
AA seq 301 aa
MRNLDEETITQAVLARNVDMKDRRLKEVMTSLIQHLHAFAREIKLTEEEWAAGIQFLTEV
GHTCSPSRQEFILLSDTLGLSTLVTAQNHRKPRGCTEATVFGPFYVDDAPDYELGDDVGN
GMAGEPCYVSGQVRSITGEAVPGAKIEVWQADADGFYDVQNPDRSHAQGRGTLTADDTGH
FRFRSIVAECYPIPHDGPVGRMLDAMGRHPWRPAHLHFMISAPGYETLVTHVFRNDSDYL
DSDAVFGVRSSLVADWVRHKPGSTPDGGESAVPFYTLDYDFVLNPAAPAAPVPESPQQTT
R
NT seq 906 nt   +upstreamnt  +downstreamnt
atgcgcaatctcgacgaagaaaccatcacccaggcagtgctggcccgcaatgtcgatatg
aaggaccgccgcctcaaggaggtcatgaccagcctgatccagcacctgcacgcgttcgcg
cgcgagatcaagctgaccgaggaggaatgggcggcgggcatccagttcctgaccgaagtg
ggccatacctgcagcccgagccggcaggagttcatcctgctgtccgacacgctgggcctg
tcgacgctcgtgactgcgcagaaccaccgcaagccgcgtggctgcaccgaggcgaccgtg
ttcgggccgttctatgtggacgacgcgcctgactatgaactcggcgacgacgttggcaat
ggcatggccggcgagccctgctatgtcagcggacaggtgcgcagcatcaccggcgaggcc
gtgcccggcgcgaagatcgaggtctggcaggcggatgccgatggcttctacgatgtgcag
aatcctgaccggagccatgcacagggccgcggcacgctgacggccgatgacaccggtcac
ttccgcttccggtctatcgtcgccgagtgctacccgatcccgcatgacggcccggtcggc
cgcatgcttgacgccatgggccggcacccgtggcggccggctcacctccatttcatgatc
tccgcgcccggctacgagacgctggtcacgcacgtattccgcaacgacagcgactacctc
gactcggacgccgtcttcggcgtgcgttcgtcactggtggcggactgggtccggcataag
ccgggcagcaccccggacggcggagaaagtgccgtgcccttctatacgctcgactacgac
ttcgtgctcaatccggccgccccggccgccccggtacccgaaagcccccaacaaacaacg
aggtaa

DBGET integrated database retrieval system