KEGG   Cupriavidus pinatubonensis JMP134: Reut_A1589
Entry
Reut_A1589        CDS       T00268                                 
Name
(GenBank) maleylacetate reductase
  KO
K00217  maleylacetate reductase [EC:1.3.1.32]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00361  Chlorocyclohexane and chlorobenzene degradation
reu00362  Benzoate degradation
reu00364  Fluorobenzoate degradation
reu00623  Toluene degradation
reu01100  Metabolic pathways
reu01120  Microbial metabolism in diverse environments
reu01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Reut_A1589
   00364 Fluorobenzoate degradation
    Reut_A1589
   00361 Chlorocyclohexane and chlorobenzene degradation
    Reut_A1589
   00623 Toluene degradation
    Reut_A1589
Enzymes [BR:reu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.32  maleylacetate reductase
     Reut_A1589
SSDB
Motif
Pfam: Fe-ADH Fe-ADH_2 NAD_kinase
Other DBs
NCBI-ProteinID: AAZ60955
UniProt: Q471H8
LinkDB
Position
1:1712101..1713168
AA seq 355 aa
MKAFQYAARAQRIVFGAGTIRQVGEEIDALGASSVLVLSTPEQRRLAEQVSDLLGARAIG
IFDRAVMHVPVETARAACAMAFELGADSVVAIGGGSTTGLAKAIALEMSVPVLAIPTTYA
GSEMTTIYGLTDAGLKRTGTDVRVLPRTVIYDPELTYLLPAAISVTSGINALAHAAEGLY
AHDRNPISDLMAREGIQAMAAALPALVSERDTARLREARAQALYGAWLCGAVLGSVGVAL
HHKLCHTLGGSFNLPHAETHTIILPHALAYNAKAAPDAMASIAQALGADNAAQGAFDLAR
TTGAPLGLRQIGMREDELDKACEIALQNQYPNPRPLEAGAIRELLQNAWEGRRPV
NT seq 1068 nt   +upstreamnt  +downstreamnt
atgaaagcattccagtacgccgcgcgcgcccagcgcatcgtctttggcgccggcacgatc
cggcaagtcggcgaggaaatcgatgcactgggcgcatccagtgtcctggtgctcagcacc
cccgagcagcgccggctggccgaacaggtgtcggacctgcttggcgcccgcgcgatcggc
atctttgaccgcgccgtgatgcacgtgccggtcgagacggcgcgcgcggcctgcgcgatg
gcattcgagctgggcgccgacagcgtggtggcgatcggtggcggctccacgacggggctc
gccaaggccatcgccctcgagatgagcgtgcccgtgctggcgattcccaccacctatgcc
ggctcggagatgactacgatatacggcctcaccgatgcgggcctgaagcgtactgggact
gacgtgcgagtgctgccgcgcactgtcatctacgatcctgaactgacctacttgctgccg
gcggcgatcagcgtgaccagcggcatcaacgcactcgcgcacgcagcagaaggtttgtac
gcccatgaccgcaacccgatttcggacctgatggcaagggaaggcattcaggccatggcg
gcggcgctgcccgcgctcgtcagcgaacgggataccgccaggttgcgcgaggcgcgcgcg
caagccctgtatggcgcgtggttatgcggagcagtgcttggcagtgtgggggtggcgttg
catcacaagctctgccacacgcttggaggcagcttcaacctgccgcatgcggaaacgcac
acgatcatcctgccgcacgcgctggcctacaacgcgaaggctgcgccggacgccatggcc
tccatcgcgcaggccctgggcgcagacaatgcggcacaaggagctttcgacctggcgcgc
acgaccggtgcgccgttggggttgcgccagatcggcatgcgcgaggacgaactcgacaag
gcttgcgagatcgcgctgcagaaccagtacccgaacccgcgtccgcttgaagctggggcg
atccgtgaattgctgcagaacgcgtgggaggggcgtcggcccgtttga

KEGG   Cupriavidus pinatubonensis JMP134: Reut_B4129
Entry
Reut_B4129        CDS       T00268                                 
Name
(GenBank) maleylacetate reductase
  KO
K00217  maleylacetate reductase [EC:1.3.1.32]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00361  Chlorocyclohexane and chlorobenzene degradation
reu00362  Benzoate degradation
reu00364  Fluorobenzoate degradation
reu00623  Toluene degradation
reu01100  Metabolic pathways
reu01120  Microbial metabolism in diverse environments
reu01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Reut_B4129
   00364 Fluorobenzoate degradation
    Reut_B4129
   00361 Chlorocyclohexane and chlorobenzene degradation
    Reut_B4129
   00623 Toluene degradation
    Reut_B4129
Enzymes [BR:reu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.32  maleylacetate reductase
     Reut_B4129
SSDB
Motif
Pfam: Fe-ADH Fe-ADH_2 NAD_kinase AIRC
Other DBs
NCBI-ProteinID: AAZ63483
UniProt: Q46TQ1
Structure
LinkDB
Position
2:767512..768585
AA seq 357 aa
MKSSQPFIYEAHAARVVFGAGSSSQVAAEVERLGAKRALVLCTPNQQAEAERIADLLGPL
SAGVYAGAVMHVPIESARDATARAREAGADCAVAVGGGSTTGLGKAIALETGMPIVAIPT
TYAGSEVTPVYGLTEAGTKRTGRDPRVLPRTVIYDPALTVGLPRGLSVTSALNAIAHAAE
GLYARDANPVMSLMAEEGIRALAAGIPAVFNDPADLDARSQCLYGAWLCGTVLGGVGMAL
HHKLCHTLGGSFNLPHAETHTIVLPHALAYNAAAVPEAMARIRRATGAGEQSAAATLFDL
AQRHGAPVALRDIGMREEDLDRAADIALASPYWNPRPIEREPIRALLQAAYEGVRPD
NT seq 1074 nt   +upstreamnt  +downstreamnt
atgaaatcgtcacagccattcatctatgaggcacacgcggcgcgcgtcgtgtttggcgcg
gggtcttcaagccaggttgccgccgaagtcgaaaggctcggcgccaagcgggccctggtg
ctctgcacgccgaaccagcaggcggaggccgagcgcattgccgacttgcttggccccttg
tccgcaggcgtgtatgcgggcgccgtcatgcacgtgccgatcgagagtgcgcgcgacgca
acagcgcgggcgcgcgaggccggagcggattgcgccgtggcagtcggcggtggatcgacc
acgggacttggcaaggccatcgccctggaaacggggatgccgatcgtggcgatcccaacc
acctacgcgggctccgaagtgacgccggtctatggtctcaccgaagccggcacgaagcgc
accggccgcgatccgcgcgtgctgccgcgcacggtgatctacgatcccgcactgaccgtc
ggcttgccgcgcggcctgtccgtcacgagcgcgttgaatgcgattgcccatgccgccgag
ggcctgtacgcgcgtgacgccaaccccgtgatgtcgctgatggccgaggaaggcattcgc
gcgctcgccgcgggcattccagcggtattcaacgatccggccgacctcgacgcgcgttcc
cagtgcctgtacggagcgtggctgtgtggcaccgtgcttggtggcgtcggcatggcgctt
catcacaagctgtgccatacgctgggtggcagcttcaacctgcctcacgccgaaacgcac
accatcgtgttgccgcatgcgctggcctataacgccgccgccgtgccagaggcgatggcc
cgcatccgcagggcgaccggcgccggcgagcaatccgctgcagcgacgctgttcgacctg
gcccagcgccatggcgcccctgtcgccctgcgggacatcggcatgcgcgaagaggatctc
gaccgcgcggcggatatcgcgctcgccagcccctactggaacccgcgcccgatcgagcgc
gagccgatccgtgccctgctccaggctgcctacgaaggcgtgcggccggactga

KEGG   Cupriavidus pinatubonensis JMP134: Reut_B4694
Entry
Reut_B4694        CDS       T00268                                 
Name
(GenBank) maleylacetate reductase
  KO
K00217  maleylacetate reductase [EC:1.3.1.32]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00361  Chlorocyclohexane and chlorobenzene degradation
reu00362  Benzoate degradation
reu00364  Fluorobenzoate degradation
reu00623  Toluene degradation
reu01100  Metabolic pathways
reu01120  Microbial metabolism in diverse environments
reu01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Reut_B4694
   00364 Fluorobenzoate degradation
    Reut_B4694
   00361 Chlorocyclohexane and chlorobenzene degradation
    Reut_B4694
   00623 Toluene degradation
    Reut_B4694
Enzymes [BR:reu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.32  maleylacetate reductase
     Reut_B4694
SSDB
Motif
Pfam: Fe-ADH Fe-ADH_2
Other DBs
NCBI-ProteinID: AAZ64043
UniProt: Q46S41
LinkDB
Position
2:complement(1392847..1393905)
AA seq 352 aa
MEPFVHETRASRVVFGPGARRLLPRELGHLGIARVLVLTTPEQAALGREVAGLLGDRSVG
VYSKAVMHVPAEVARAAVATAAGLGADGCIAVGGGSTIGLAKAIALESGLPIIALPTTYA
GSEMTPLYGITEASIKKTGRDWRVMPRAVVYDPELTLTLPAPLSMTSGMNAMAHAAEALY
APDGNPVFSMMAEEGIRALAMALPRLREAPQDLGARSDALYGAWLCGTVLGNLQMGLHHK
LCHTLGGSFNLPHAEVHTVILPYAMAYNAPSAPQAMVRIARALGRDAAPAGMWQLGSALG
APRSLREIGMPADGLDRAADLVVASPYPNPRPFELAPIRALLQRAYDGHMPG
NT seq 1059 nt   +upstreamnt  +downstreamnt
atggagccgtttgtccacgaaacgcgcgcatcgcgcgtggtctttggtcccggggcccgc
cgtttactgccgcgtgaactcgggcatctggggatcgcacgggtgctggtcctgaccacg
ccggaacaggccgcgctcggccgcgaggttgccggattgctgggcgaccgctcggttggc
gtgtacagcaaggccgtgatgcatgtgccggccgaggtcgcgcgggcggcggtggccact
gcggcgggactcggcgcggacggctgtatcgcggtgggaggcggctcgaccatcggcctg
gcgaaggccattgcgctggagtccggcctgccgatcatcgctttgccgacgacctatgcc
ggctccgagatgacgccgctgtatggcatcacggaagcgtcgatcaagaagaccggacga
gactggcgggtcatgccgcgtgccgtggtctacgatcccgaactgacgctcacgctgcca
gccccgctcagcatgaccagcggtatgaacgccatggcgcatgccgcggaagcgctgtac
gcgccagatggcaacccggtcttcagcatgatggcggaagagggcatccgcgccctggcc
atggcgctaccgcgcctgcgcgaagcgccacaggacctgggcgcccgcagcgacgcgttg
tatggcgcatggctgtgcggcaccgtcctgggcaatctgcagatgggcttgcaccacaag
ctgtgccatacgctgggcggcagcttcaacctgccgcacgcggaagtccacaccgtcatc
ctgccttatgcgatggcctacaacgcgccctcggcgccgcaggccatggtgcgcatcgcg
cgcgcgctggggcgcgatgccgcgccggcgggaatgtggcagctcggttctgcactcggg
gcgccgcgctcgctgcgcgagatcggcatgccggccgacggcctggaccgcgcggcggac
ctggtggtggccagcccgtatcccaatccgcgcccgttcgaactggcgccgatccgcgcg
ttgctgcaacgtgcgtacgacggccacatgccgggctga

KEGG   Cupriavidus pinatubonensis JMP134: Reut_D6463
Entry
Reut_D6463        CDS       T00268                                 
Name
(GenBank) Iron-containing alcohol dehydrogenase
  KO
K00217  maleylacetate reductase [EC:1.3.1.32]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00361  Chlorocyclohexane and chlorobenzene degradation
reu00362  Benzoate degradation
reu00364  Fluorobenzoate degradation
reu00623  Toluene degradation
reu01100  Metabolic pathways
reu01120  Microbial metabolism in diverse environments
reu01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Reut_D6463
   00364 Fluorobenzoate degradation
    Reut_D6463
   00361 Chlorocyclohexane and chlorobenzene degradation
    Reut_D6463
   00623 Toluene degradation
    Reut_D6463
Enzymes [BR:reu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.32  maleylacetate reductase
     Reut_D6463
SSDB
Motif
Pfam: Fe-ADH Fe-ADH_2
Other DBs
NCBI-ProteinID: AAZ65761
UniProt: P27137
LinkDB
Position
p1:complement(19829..20893)
AA seq 354 aa
MKKFTLDYLSPRVVFGAGTASALPDEIGRLGARRPLVLSSPEQRELAKDIVRPIGDRVAG
YFDGATMHVPVDVIQKAERAFNDTDADSIIAIGGGSTTGLAKILSMNLDVPSLVIPTTYA
GSEMTTIWGVTEGGMKRTGRDPKVLPKTVIYDPLLTVDLPLAISVTSALNAIAHAAEGLY
SADLNPVLETMCKQGICALFDAIPRLVAKPTDAEARTDALFGAWMCGTALCHLGMGLHHK
LCHTLGGTLNLPHAETHAIVLPHALAYNLPYAAPAERLLQEVAGSSDVPSALYDLARNAG
APLSLAEIGMRPEDIPRVRDLALRDQYPNPRPLESDALETLLVNAFRGRRPDFK
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgaagaagttcacgcttgactacctgagcccgagggtcgtcttcggggcgggcactgct
tctgcattgccagatgaaataggacgccttggcgcacgccggcccttggtattaagcagc
ccggaacaacgcgagttagcgaaggatatcgtccgtccgataggtgacagggtagctgga
tatttcgatggcgcgacgatgcatgttcccgtcgacgtcatccagaaagccgagcgggct
tttaacgatactgacgccgactcaatcatcgcgatcgggggaggatcgaccaccggactc
gcaaaaatcctttcgatgaaccttgacgtcccaagtctggttataccaacgacctatgcc
ggtagtgaaatgactaccatttggggtgtcacggaaggcggaatgaagaggaccggccgc
gaccccaaggtgctaccgaagaccgtgatttatgatccattgctcacggtcgatttgccg
cttgctatctcggtgacgagcgccttgaatgcgatcgctcacgccgcagaaggtctgtac
tcggccgacctcaatcccgttctcgagaccatgtgtaagcagggcatatgcgccttgttc
gatgcaatcccgcgcctggtggcaaagccgactgacgccgaagcgcgtacggatgccctt
tttggggcatggatgtgtggcactgcactgtgccacttgggcatggggctacatcacaaa
ctctgccacacgcttgggggaacccttaatcttccccacgcggagacacatgcaatcgta
ctaccacacgcactggcatacaatctgccgtacgccgcgccagctgagcgactgcttcag
gaagtcgccggcagtagtgacgtcccgagcgcgctatatgatctcgccagaaatgctgga
gcaccactcagtctcgccgaaatcggtatgcggcctgaagatattccgagggtacgcgac
ctcgcgctaagggaccaatatccgaatccgcgtccgctggaatcggacgcattggaaaca
ttgttagtcaatgcgtttcgtgggcgaagaccggatttcaaataa

KEGG   Cupriavidus pinatubonensis JMP134: Reut_D6471
Entry
Reut_D6471        CDS       T00268                                 
Name
(GenBank) Iron-containing alcohol dehydrogenase
  KO
K00217  maleylacetate reductase [EC:1.3.1.32]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00361  Chlorocyclohexane and chlorobenzene degradation
reu00362  Benzoate degradation
reu00364  Fluorobenzoate degradation
reu00623  Toluene degradation
reu01100  Metabolic pathways
reu01120  Microbial metabolism in diverse environments
reu01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Reut_D6471
   00364 Fluorobenzoate degradation
    Reut_D6471
   00361 Chlorocyclohexane and chlorobenzene degradation
    Reut_D6471
   00623 Toluene degradation
    Reut_D6471
Enzymes [BR:reu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.32  maleylacetate reductase
     Reut_D6471
SSDB
Motif
Pfam: Fe-ADH Fe-ADH_2 DHQ_synthase
Other DBs
NCBI-ProteinID: AAZ65769
UniProt: P94135
LinkDB
Position
p1:complement(28593..29672)
AA seq 359 aa
MTGDLNEFVAHFWPVRVVFGAGSTERIPAEVKRLGARRALVLCTPDQRDLAQRVLGDLGD
LGAGFHDGAVMHVPEASVTRAAQAARDADADLLVAVGGGSTIGLAKALALHHGMRFVALP
TTYAGSEMTPIWGLTADGAKRTGRDPRVLPSTVLYDPHHLTSLPPEVTGPSGMNAIAHAV
ESMYAPDRNPITMLLAEESIRAMAQGLPVAVDSPGDLDARTRTLYAAWLAGTVLGMVSMG
LHHKLCHVLGGRFNLPHAPMHAVLLPHVAAFNEVAAPAELGRVAAALGAPGPGGAGAALH
ALLRFTCTERSLAAIGMPAQGIYDAAEHALADAYANPRQASREDIARLLRAAFTGEMPA
NT seq 1080 nt   +upstreamnt  +downstreamnt
gtgaccggcgatctgaatgaattcgttgcgcacttctggccggtcagggtcgtcttcggc
gctggatcgaccgaacggatccccgcggaggtcaagcgcctgggtgcacgacgcgcactg
gtgctctgcacgccggaccagcgcgatctggcgcagcgggtgctcggcgatctcggcgac
ctgggcgcgggcttccatgacggcgccgtcatgcacgtgcccgaggcgtcggtcacgcgc
gccgcgcaagcggcccgggacgccgacgcggacctgctcgtggcggtcggcggcggctcg
accatcggactggccaaggcgctcgcgcttcatcacggaatgcgcttcgtcgccttgccg
acgacctatgcgggttcggagatgacgcccatctggggcttgaccgccgatggcgcgaag
cgcacgggccgggatcctcgcgtgctgcccagcaccgtcctctacgacccgcatcacctg
acctccttgccgccggaggtcaccggcccgagcggcatgaacgcgatcgcgcacgccgtg
gagtcgatgtacgccccggaccgcaacccgatcaccatgctgctggccgaagaaagcatt
cgcgcgatggcgcagggactgcccgtcgccgtcgactcgcccggcgatctcgatgcgcgc
acgcgcacgctctatgccgcctggctcgcgggaacggtactgggcatggtctcgatgggc
ctgcaccacaagctctgccatgtgctcggggggcgattcaacctgccgcatgcgccgatg
cacgccgtgttgttgcctcacgtggcggccttcaacgaggtggctgcgcccgcggaactc
ggacgcgtcgcggccgcactcggcgcgccggggcccggcggcgccggcgcggccttgcat
gcattgctgcgattcacttgcacggaaagatcgctggcggccatcggcatgccggcgcaa
ggcatctacgacgccgcggaacacgcgctcgccgatgcctatgcgaatccacgccaggcg
agccgcgaagacatcgctcgcctgctgcgagccgctttcaccggagaaatgccggcgtga

DBGET integrated database retrieval system