KEGG   Cupriavidus pinatubonensis JMP134: Reut_A1699
Entry
Reut_A1699        CDS       T00268                                 
Name
(GenBank) phenol 2-monooxygenase P0 subunit
  KO
K16249  phenol/toluene 2-monooxygenase (NADH) P0/A0
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00361  Chlorocyclohexane and chlorobenzene degradation
reu00362  Benzoate degradation
reu00623  Toluene degradation
reu01100  Metabolic pathways
reu01120  Microbial metabolism in diverse environments
reu01220  Degradation of aromatic compounds
Module
reu_M00548  Benzene degradation, benzene => catechol
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Reut_A1699
   00361 Chlorocyclohexane and chlorobenzene degradation
    Reut_A1699
   00623 Toluene degradation
    Reut_A1699
SSDB
Motif
Pfam: Phenol_hyd_sub
Other DBs
NCBI-ProteinID: AAZ61064
UniProt: Q470W9
LinkDB
Position
1:1834957..1835211
AA seq 84 aa
MTTPIVHSASSASRRSQPYVRVTSHGQQWVEFEFSLGDPALYVELVMRPDQFTAFCAAQC
AITVSHQLGRALERERDKWCETVA
NT seq 255 nt   +upstreamnt  +downstreamnt
atgaccacgcccatcgtccattccgcctcgtcagcttcccgccggtcgcagccctacgtc
cgggtgacctcgcacggccagcaatgggtcgagttcgagttctcgctcggagaccccgcg
ctgtatgtggagctggtcatgcgccctgaccagttcaccgcgttctgcgcggcgcagtgc
gccatcacggtgtcgcatcagctcggccgtgcgctggaacgcgaacgcgacaaatggtgc
gagaccgtggcctga

KEGG   Cupriavidus pinatubonensis JMP134: Reut_A1700
Entry
Reut_A1700        CDS       T00268                                 
Name
(GenBank) phenol 2-monooxygenase P1 subunit
  KO
K16243  phenol/toluene 2-monooxygenase (NADH) P1/A1 [EC:1.14.13.244 1.14.13.243]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00361  Chlorocyclohexane and chlorobenzene degradation
reu00362  Benzoate degradation
reu00623  Toluene degradation
reu01100  Metabolic pathways
reu01120  Microbial metabolism in diverse environments
reu01220  Degradation of aromatic compounds
Module
reu_M00548  Benzene degradation, benzene => catechol
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Reut_A1700
   00361 Chlorocyclohexane and chlorobenzene degradation
    Reut_A1700
   00623 Toluene degradation
    Reut_A1700
Enzymes [BR:reu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.243  toluene 2-monooxygenase
     Reut_A1700
    1.14.13.244  phenol 2-monooxygenase (NADH)
     Reut_A1700
SSDB
Motif
Pfam: Phenol_Hydrox
Other DBs
NCBI-ProteinID: AAZ61065
UniProt: Q470W8
LinkDB
Position
1:1835259..1836281
AA seq 340 aa
MQIDIRTDSVSPIRQTFANLARRLGADKPATRYQEAMYDLQPETSFHYRPLWQPQYELYD
ARRTQVVMQDWYALKDPRQFYYGSYVNARARQQEMMEKNLEFVEKRGLLASLPEPLREVL
TSGVVPLRHVEWAANMNNAAITAYGFGSAITEAAMFQTMDRLGIAQYLTRIGLLVGDKAA
VDAAKAAWLEDLAWQPLRHAIEDLLVRDDWFELHVAQNLVMDGLLYPLIYQRLDARLSAE
SPAFSLVTDFMNAWYAETARWVDATVKTAAQESPENASVIAGYAFTWLDRFQHALAPLAR
RLFAGDAGAALDESVAALTKRLAGLGLTRATDETPAKAAA
NT seq 1023 nt   +upstreamnt  +downstreamnt
atgcaaatcgatatccgcacggacagcgtcagcccgatccgccagaccttcgccaacctg
gcgcgccgcctcggcgcagacaagccggccacgcgctaccaggaggcaatgtacgacctg
cagccggaaaccagcttccactaccgcccgctgtggcagccacagtacgagctgtacgac
gcgcgccgcacgcaggtggtcatgcaggactggtacgcgctgaaggacccgcgccagttc
tactacggcagctacgtcaacgcccgcgcacgccagcaggaaatgatggaaaagaacctg
gagttcgtggagaagcgcggcctgctggcatcgctgcccgagccgctgcgcgaggtgctg
acgagcggcgtggtgccgctgcgccatgtcgaatgggcggccaacatgaacaacgccgcc
atcaccgcgtatggctttggctccgccatcaccgaagcggcgatgttccagacgatggat
cgcctcggcatcgcgcagtacctgacccgcatcggcctgctggtgggcgacaaggccgcc
gtcgacgcggccaaggcggcatggctggaagacctggcctggcagcctctgcgccatgcg
atcgaggacctgctggtgcgcgatgactggttcgaactgcacgttgcgcagaacctggtg
atggacgggctgctgtacccactgatctaccagcgcctcgatgcacgcctgtccgccgaa
agcccggcgttctcgctggtcaccgacttcatgaacgcctggtacgccgagacggcgcgc
tgggtcgatgccacggtcaaaaccgctgcgcaggagtcgcccgagaacgccagcgtgatc
gccggctatgccttcacctggctcgaccgcttccagcatgcgctggcaccgctcgcgcgc
cgcctgttcgctggcgatgctggagctgcgctggacgagtctgtggccgctctgaccaag
cggcttgcgggactgggtctgacccgtgccactgacgaaacaccggctaaggccgctgcc
tga

KEGG   Cupriavidus pinatubonensis JMP134: Reut_A1701
Entry
Reut_A1701        CDS       T00268                                 
Name
(GenBank) phenol 2-monooxygenase P2 subunit
  KO
K16244  phenol/toluene 2-monooxygenase (NADH) P2/A2 [EC:1.14.13.244 1.14.13.243]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00361  Chlorocyclohexane and chlorobenzene degradation
reu00362  Benzoate degradation
reu00623  Toluene degradation
reu01100  Metabolic pathways
reu01120  Microbial metabolism in diverse environments
reu01220  Degradation of aromatic compounds
Module
reu_M00548  Benzene degradation, benzene => catechol
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Reut_A1701
   00361 Chlorocyclohexane and chlorobenzene degradation
    Reut_A1701
   00623 Toluene degradation
    Reut_A1701
Enzymes [BR:reu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.243  toluene 2-monooxygenase
     Reut_A1701
    1.14.13.244  phenol 2-monooxygenase (NADH)
     Reut_A1701
SSDB
Motif
Pfam: MmoB_DmpM
Other DBs
NCBI-ProteinID: AAZ61066
UniProt: Q470W7
LinkDB
Position
1:1836298..1836570
AA seq 90 aa
MTAQIVFIALQANEEMRPVIDAIEADNPHATVNRYPAMVKIDAPGRLEINRASVEERMGR
AWDVQELQLGLISLAGNIDETEDQFVLAWH
NT seq 273 nt   +upstreamnt  +downstreamnt
atgaccgcacagatcgtattcatcgcgctgcaggccaacgaggagatgcgtcccgtcatc
gacgccatcgaggccgacaacccgcacgccaccgtcaaccgctacccggccatggtcaag
atcgacgcgcccggacggctcgagatcaaccgcgccagcgtggaagagcgcatgggacgc
gcgtgggacgtgcaggaactgcagctcggcctgatctcgctggccggcaacatcgacgag
accgaagaccagttcgtgctggcctggcactga

KEGG   Cupriavidus pinatubonensis JMP134: Reut_A1702
Entry
Reut_A1702        CDS       T00268                                 
Name
(GenBank) phenol 2-monooxygenase P3 subunit
  KO
K16242  phenol/toluene 2-monooxygenase (NADH) P3/A3 [EC:1.14.13.244 1.14.13.243]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00361  Chlorocyclohexane and chlorobenzene degradation
reu00362  Benzoate degradation
reu00623  Toluene degradation
reu01100  Metabolic pathways
reu01120  Microbial metabolism in diverse environments
reu01220  Degradation of aromatic compounds
Module
reu_M00548  Benzene degradation, benzene => catechol
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Reut_A1702
   00361 Chlorocyclohexane and chlorobenzene degradation
    Reut_A1702
   00623 Toluene degradation
    Reut_A1702
Enzymes [BR:reu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.243  toluene 2-monooxygenase
     Reut_A1702
    1.14.13.244  phenol 2-monooxygenase (NADH)
     Reut_A1702
SSDB
Motif
Pfam: Phenol_Hydrox YHS
Other DBs
NCBI-ProteinID: AAZ61067
UniProt: Q470W6
LinkDB
Position
1:1836608..1838200
AA seq 530 aa
MTTATAIASAARQAARPKLSLKEKYAILTRDLGWETTYQPMDAVFPQDKFEGIVIHDWDG
WEDPFRLTMDAYWKFQSEKERKLYAIIDAFQQNNGQLNVTDARYVNALKLFLTGVSPLEY
AAHRGFAMAGRTLRGVGARVACQMQSVDELRHCQTQIHTISHYNKYFNGFADWRHLHDRL
WYLSVPKSYFEDAMTAGPFEFITAISFSFEYVLTNLLFMPFMSGAAYNGDMATVTFGFSA
QSDESRHMTLGLEVVKFMLEQDPANRPIIQKWIDKWFWRGYRLLTLVAMMMDYMLPKRVM
SWKEAWEIYFEQNGGALFADLARYGIRMPKYHEQAAKEKDHLSHIAWSIFYNFNHAAAIH
TWVPEPSEMDWLAEKYPDSFDKHYRPRFDYWQQQQEAGQRWFNPGLPMLCQVCQIPMAFT
EPGDPTQICYREAEHDGDHYHFCSDGCRDIFLGEPEKYVQAWLPVHQIFQGNCGGATLPE
VLDWYHLRPEDRGDYADSQDRANWQRWTGAQSAQPAEQGSGAACCDHKHD
NT seq 1593 nt   +upstreamnt  +downstreamnt
atgaccaccgccaccgcaatcgcctccgccgctcggcaagccgccaggcccaagctgtcg
ctcaaggaaaagtacgccatccttacgcgcgacctcggctgggaaacgacctatcagccg
atggatgccgtattcccgcaagacaagttcgaaggcatcgtgatccatgactgggatggg
tgggaagacccgttccgcctgaccatggacgcgtactggaaattccagtccgagaaggaa
cgcaagctgtacgcgatcatcgacgcgttccagcagaacaacggccagctcaacgtcacc
gatgcgcgctacgtgaacgcactgaagctgttcctgaccggcgtgtcgccactggaatat
gccgcgcaccgcggcttcgcgatggccggccgcacgctgcgcggcgtcggcgcgcgcgtg
gcgtgccagatgcagtcggtcgacgagctgcgccactgccagacccagatccacaccatc
agccactacaacaagtacttcaacggctttgccgactggcgccacctgcatgaccggctg
tggtacctgtcggtgccgaagtcgtacttcgaggacgccatgacggcggggccgttcgag
ttcatcacggcgatctcgttctcgttcgaatatgtgctgaccaacctgctgttcatgccg
ttcatgtcgggcgcggcgtacaacggcgacatggccaccgtgacgttcggtttctcggcg
cagtcggacgaatcgcgccacatgaccctcggactcgaagtggtgaagttcatgctggaa
caggacccggcgaatcgcccgatcatccagaagtggatcgacaagtggttctggcgcggc
tacaggctgctcacgctggtggcgatgatgatggactacatgctgcccaaacgcgtgatg
agctggaaggaagcgtgggagatttacttcgagcagaacggcggtgcgctgttcgccgac
ctggcacgctatggcatccgcatgccgaagtaccacgagcaggccgccaaggagaaggac
cacctgtcgcacatcgcatggtcgatcttctataacttcaaccacgccgcggcgatccac
acctgggtgcctgaaccatcggaaatggactggctcgcggagaagtatcccgacagcttc
gacaagcactaccgcccgcgcttcgactactggcagcagcaacaggaggcagggcagcgc
tggttcaaccctggcctgccgatgttgtgccaggtgtgccagatcccgatggccttcacc
gagccgggtgaccccacccagatctgctaccgcgaggccgagcacgacggcgaccactat
cacttctgctccgacggctgccgcgacatcttcctcggcgaacccgagaaatacgtccag
gcctggctgccggtgcaccagatcttccagggcaattgcggcggcgccacgttgcctgaa
gtgctggactggtaccacctgcgtcccgaagaccgcggcgactatgccgattcacaggac
cgcgcgaactggcagcgctggaccggggcccagagcgcgcagccggcggagcagggcagt
ggcgccgcgtgctgcgaccacaaacacgactaa

KEGG   Cupriavidus pinatubonensis JMP134: Reut_A1703
Entry
Reut_A1703        CDS       T00268                                 
Name
(GenBank) phenol 2-monooxygenase P4 subunit
  KO
K16245  phenol/toluene 2-monooxygenase (NADH) P4/A4 [EC:1.14.13.244 1.14.13.243]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00361  Chlorocyclohexane and chlorobenzene degradation
reu00362  Benzoate degradation
reu00623  Toluene degradation
reu01100  Metabolic pathways
reu01120  Microbial metabolism in diverse environments
reu01220  Degradation of aromatic compounds
Module
reu_M00548  Benzene degradation, benzene => catechol
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Reut_A1703
   00361 Chlorocyclohexane and chlorobenzene degradation
    Reut_A1703
   00623 Toluene degradation
    Reut_A1703
Enzymes [BR:reu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.243  toluene 2-monooxygenase
     Reut_A1703
    1.14.13.244  phenol 2-monooxygenase (NADH)
     Reut_A1703
SSDB
Motif
Pfam: Phenol_monoox
Other DBs
NCBI-ProteinID: AAZ61068
UniProt: Q470W5
LinkDB
Position
1:1838220..1838582
AA seq 120 aa
MPVIALNPGYAGETRDRVENFHGNQLVYFGWDQHLLFCSPFTLPLPPDMPFGTMVSDVIA
PLLAAHPEGAAIDWTQVQWLLGGEPFAPDADASLAVNGLGHKSLLRLRTPELRGIAGSCN
NT seq 363 nt   +upstreamnt  +downstreamnt
atgccagtcatcgcactgaacccgggctacgcgggcgaaacccgcgaccgcgtcgagaac
ttccacggcaaccagctcgtgtatttcggctgggaccagcacctgctgttctgcagcccg
ttcacgctgccgctgccgcccgacatgccgttcggcaccatggtcagcgacgtcatcgcg
ccactgctcgccgcgcatcccgaaggcgcggctatcgactggacgcaggtgcagtggctg
ctcggcggcgagccctttgcgccggatgcggacgccagcctggccgtcaacgggctcggc
cacaagtcgctactgcgcctgcgcacgccggaactccgcggcattgccggctcgtgcaac
tga

KEGG   Cupriavidus pinatubonensis JMP134: Reut_A1704
Entry
Reut_A1704        CDS       T00268                                 
Name
(GenBank) phenol 2-monooxygenase P5 subunit
  KO
K16246  phenol/toluene 2-monooxygenase (NADH) P5/A5 [EC:1.14.13.244 1.14.13.243]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00361  Chlorocyclohexane and chlorobenzene degradation
reu00362  Benzoate degradation
reu00623  Toluene degradation
reu01100  Metabolic pathways
reu01120  Microbial metabolism in diverse environments
reu01220  Degradation of aromatic compounds
Module
reu_M00548  Benzene degradation, benzene => catechol
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Reut_A1704
   00361 Chlorocyclohexane and chlorobenzene degradation
    Reut_A1704
   00623 Toluene degradation
    Reut_A1704
Enzymes [BR:reu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.243  toluene 2-monooxygenase
     Reut_A1704
    1.14.13.244  phenol 2-monooxygenase (NADH)
     Reut_A1704
SSDB
Motif
Pfam: NAD_binding_1 Fer2 FAD_binding_6 Fer2_4
Other DBs
NCBI-ProteinID: AAZ61069
UniProt: Q470W4
LinkDB
Position
1:1838599..1839657
AA seq 352 aa
MTYQLTIEPLGQTIGIEEGQTVLDACLRAGVWLPHACGHGLCGTCKVQTLEGELDHGEAS
PFALMDFEREEAKCLACCAKPMSDMVIEVDIEPDPDAQCLPLMDFTAEVVRIEALTPTIK
GVFLRIEGEPLQFQPGQYVNVWIGKEAAPRAFSIASAPTAGEIELNIRLVPGGSATTYVH
EQLSVGERLQLSGPLGRFFVRKSDPRPLVFMAGGSGLSSPRSMILDLLESGDQREIVLVQ
GARNAGELYYRDAFEALARQHDNFTYLPVLSGEPEQSDWGGERGYVHDLASRHFSQDFRG
WRAYLCGPPPMIEACIATLMQGRLFEKDIFTEKFLSAADASQATRSPLFRSL
NT seq 1059 nt   +upstreamnt  +downstreamnt
atgacctaccaactgaccatcgagcccctcgggcagaccataggcatcgaggaaggccaa
accgtgctcgacgcgtgcctgcgcgccggcgtgtggttgccgcatgcgtgcggccacggt
ctatgcgggacctgcaaggtgcagacgctcgaaggcgaactcgatcacggcgaagcatcg
ccattcgcgctgatggatttcgagcgcgaagaagccaagtgcctggcctgctgcgcgaag
ccgatgtccgacatggtgatcgaggtcgatatcgagcccgatcccgatgcgcagtgcctg
ccgctgatggatttcaccgcggaagtcgtgcgcatcgaggcgctgacgcccaccatcaag
ggcgtgttcctgcgcatcgaaggcgagccgctgcagttccagccgggccagtacgtcaac
gtgtggatcggcaaggaagccgcgccacgcgccttctccatcgccagtgcgccgaccgcg
ggcgagatcgaactgaacatccggctcgtgcccggcggcagtgcgacgacctatgtgcac
gaacaacttagcgtgggtgagcgcctgcagctgtcgggcccgctgggccggttcttcgtg
cgcaagagcgatccgcggccgctggtgttcatggcgggcggctcgggactgtcaagcccg
cgttcgatgatcctggacctgctggaatcgggtgaccaacgcgaaatcgtgctggtgcag
ggcgcacgcaatgccggcgaactgtactaccgcgatgccttcgaagcgctcgcacggcag
catgacaacttcacctacctgccggtgctgtcgggcgagcccgagcaaagcgactggggc
ggcgagcgcggctatgtacacgatcttgcaagccgtcatttcagccaagacttccgcggc
tggcgtgcctacctgtgcgggccgccgccgatgatcgaggcttgcatcgccacgttgatg
caaggccgcctgttcgagaaagacatcttcaccgagaagttcctgtcggcagccgacgcg
agccaggccacccgcagcccgctgttccgctcgctctga

KEGG   Cupriavidus pinatubonensis JMP134: Reut_B5680
Entry
Reut_B5680        CDS       T00268                                 
Name
(GenBank) phenol 2-monooxygenase P0 subunit
  KO
K16249  phenol/toluene 2-monooxygenase (NADH) P0/A0
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00361  Chlorocyclohexane and chlorobenzene degradation
reu00362  Benzoate degradation
reu00623  Toluene degradation
reu01100  Metabolic pathways
reu01120  Microbial metabolism in diverse environments
reu01220  Degradation of aromatic compounds
Module
reu_M00548  Benzene degradation, benzene => catechol
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Reut_B5680
   00361 Chlorocyclohexane and chlorobenzene degradation
    Reut_B5680
   00623 Toluene degradation
    Reut_B5680
SSDB
Motif
Pfam: Phenol_hyd_sub
Other DBs
NCBI-ProteinID: AAZ65025
UniProt: Q46PA9
LinkDB
Position
2:2512944..2513153
AA seq 69 aa
MISPSATTGDALPDVDVTRKFVSRVERHDDGLVSFEFAIGWPELSVDLLLPEPAFMAFCD
RHQVTRLEN
NT seq 210 nt   +upstreamnt  +downstreamnt
atgatttccccctccgccacaaccggcgatgcactgcccgatgtcgatgtcacgcgcaag
ttcgtgagccgcgtcgagcgccatgacgacgggctggtgagcttcgagttcgccatcggc
tggccggagttgagcgtagacctgctgctgccggagccggccttcatggccttctgcgac
cggcatcaggtgacaaggctggaaaactga

KEGG   Cupriavidus pinatubonensis JMP134: Reut_B5681
Entry
Reut_B5681        CDS       T00268                                 
Name
(GenBank) phenol 2-monooxygenase P1 subunit
  KO
K16243  phenol/toluene 2-monooxygenase (NADH) P1/A1 [EC:1.14.13.244 1.14.13.243]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00361  Chlorocyclohexane and chlorobenzene degradation
reu00362  Benzoate degradation
reu00623  Toluene degradation
reu01100  Metabolic pathways
reu01120  Microbial metabolism in diverse environments
reu01220  Degradation of aromatic compounds
Module
reu_M00548  Benzene degradation, benzene => catechol
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Reut_B5681
   00361 Chlorocyclohexane and chlorobenzene degradation
    Reut_B5681
   00623 Toluene degradation
    Reut_B5681
Enzymes [BR:reu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.243  toluene 2-monooxygenase
     Reut_B5681
    1.14.13.244  phenol 2-monooxygenase (NADH)
     Reut_B5681
SSDB
Motif
Pfam: Phenol_Hydrox
Other DBs
NCBI-ProteinID: AAZ65026
UniProt: Q46PA8
LinkDB
Position
2:2513207..2514214
AA seq 335 aa
MNIDLQTREITPLRQTFAHVARLVGEGKAATRYQEATYGGQPMANFHYRPTWDPAHELFD
ASRSRIRLADWQALKDPRQFYYATWTMTRARQQEAVEANFQFVESRGLAGSMSDALRTRL
LDVLLPLRHVAWGANMNNAAICAYGYGTAFTAPAMFHAMDHLGIAQLITRLALALDEPDV
LDAGKRAWLDDPCWQDLRRYVEDTFVVQDPVELFVAQNLALDGLLYPLVYGHYVDDHVTL
HGGTAAAMLTSFMPEWHDETTRWIDAVVKAMVATAEPEAAANRELLTQWFRHWAGRAAQA
LAPVAELALGENGAAALGEVCAALDARAAKLGLAP
NT seq 1008 nt   +upstreamnt  +downstreamnt
atgaatatcgatctgcagacccgcgagatcacgccgttgcggcagacgttcgcacacgtt
gcacgacttgtcggcgaaggcaaggccgcaacccgctatcaggaggccacctatggcggg
cagcccatggccaacttccactaccggccgacgtgggacccggcgcatgaactgttcgac
gccagccgcagccgtatccgtctggccgactggcaggccctgaaggacccgcgccagttc
tactacgccacgtggacgatgacccgcgcgcggcagcaggaggcggtggaggccaacttc
cagttcgtggagtcgcgcggcctggccggttcgatgagcgatgcgctgcgcacgcggctg
ctcgacgtactgctgccgctacgccacgtggcctggggcgcgaacatgaacaacgcagcg
atctgcgcctatggctacgggacagcgttcactgcgccggcgatgttccatgcgatggac
cacctcggcatcgcgcaattgattacccgcctggcgctggcgctggacgagcccgacgtg
ctggatgctggcaagcgcgcctggctcgacgatccgtgctggcaggacctgcgccgctac
gtggaggacaccttcgtcgtgcaggacccggtggagctgttcgtcgcgcagaaccttgcg
ctcgatggcctgctgtacccgctggtctacggccattacgtcgatgaccacgtcacgctg
catggcggcacggcggcggccatgctaaccagcttcatgcccgagtggcacgacgagacc
acgcgctggatcgacgccgtcgtgaaggcgatggtcgcgacagccgagcccgaggcggct
gcgaaccgcgaactactgacgcagtggttccggcactgggccggccgcgccgcgcaggcc
ctggcgcccgtcgccgaactggcgctcggtgagaacggtgccgccgcgctcggcgaagtc
tgcgcggcgctcgatgcacgcgccgcgaagctcggcctcgcgccctga

KEGG   Cupriavidus pinatubonensis JMP134: Reut_B5682
Entry
Reut_B5682        CDS       T00268                                 
Name
(GenBank) phenol 2-monooxygenase P2 subunit
  KO
K16244  phenol/toluene 2-monooxygenase (NADH) P2/A2 [EC:1.14.13.244 1.14.13.243]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00361  Chlorocyclohexane and chlorobenzene degradation
reu00362  Benzoate degradation
reu00623  Toluene degradation
reu01100  Metabolic pathways
reu01120  Microbial metabolism in diverse environments
reu01220  Degradation of aromatic compounds
Module
reu_M00548  Benzene degradation, benzene => catechol
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Reut_B5682
   00361 Chlorocyclohexane and chlorobenzene degradation
    Reut_B5682
   00623 Toluene degradation
    Reut_B5682
Enzymes [BR:reu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.243  toluene 2-monooxygenase
     Reut_B5682
    1.14.13.244  phenol 2-monooxygenase (NADH)
     Reut_B5682
SSDB
Motif
Pfam: MmoB_DmpM
Other DBs
NCBI-ProteinID: AAZ65027
UniProt: Q46PA7
LinkDB
Position
2:2514253..2514522
AA seq 89 aa
MSQVFIAFQANEESRPVVEAIVTDNPEAVVSYPTGLVKIDAPGRLTIRRETIEEQTGRPF
DLQQLHVNLVTLSGHIDEDDDQLTLSWNH
NT seq 270 nt   +upstreamnt  +downstreamnt
atgtcccaggtctttatcgccttccaggccaatgaggaatcgcgtccggtcgtcgaagcg
atcgtgactgacaaccccgaggcggtcgtcagctatcccacggggctcgtcaagatcgat
gcccccggccggctcaccatccgtcgcgaaaccatcgaggaacagaccggccggcccttc
gacctgcagcagcttcacgtaaatctggtcacgctgtcgggccacatcgacgaagacgac
gaccagctcacgttgagctggaaccactga

KEGG   Cupriavidus pinatubonensis JMP134: Reut_B5683
Entry
Reut_B5683        CDS       T00268                                 
Name
(GenBank) phenol 2-monooxygenase P3 subunit
  KO
K16242  phenol/toluene 2-monooxygenase (NADH) P3/A3 [EC:1.14.13.244 1.14.13.243]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00361  Chlorocyclohexane and chlorobenzene degradation
reu00362  Benzoate degradation
reu00623  Toluene degradation
reu01100  Metabolic pathways
reu01120  Microbial metabolism in diverse environments
reu01220  Degradation of aromatic compounds
Module
reu_M00548  Benzene degradation, benzene => catechol
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Reut_B5683
   00361 Chlorocyclohexane and chlorobenzene degradation
    Reut_B5683
   00623 Toluene degradation
    Reut_B5683
Enzymes [BR:reu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.243  toluene 2-monooxygenase
     Reut_B5683
    1.14.13.244  phenol 2-monooxygenase (NADH)
     Reut_B5683
SSDB
Motif
Pfam: Phenol_Hydrox YHS
Other DBs
NCBI-ProteinID: AAZ65028
UniProt: Q46PA6
LinkDB
Position
2:2514572..2516116
AA seq 514 aa
MDTRVAKKKLGLKERYAAMTRGLGWETTYQPMDKVFPYDTYEGIKIHDWDKWQDPFRLTM
DAYWKYQGEKEKKLYAVIEAFAQNNGQLGVSDARYINALKLFLQGVTPLEYCAHRGFAHV
GRQFTGEGARVAAQMQSIDELRHYQTETHAISHYNKYFNGLHRAHHWFDRVWYLSVPKSF
FEDACTAGPFEFLTAVSFSFEYVLTNLLFVPFMSGAAHNGDMSTVTFGFSAQSDESRHMT
LGIECIKFMLEQDSGNVPIVQRWIDKWFWRGYRLLTIVAMMQDYMLPKRVMSWKEAWEMY
AEGSGGALFKDLARYGIREPRGWKDACEGKDHISHQAWATFYNYGAAAPFHTWLPQEEEM
QWLSQKYPESFDKLYRPRFEYWRERADEGRRFYNKTLPMLCTTCQVPMFFTEPGDATKIC
YRETSYFGNKYHFCSDHCQHIFEDEPEKYVQSWLPVHQIYQGHCFPEGTDPTAEGFDPLT
AVLQYYEMNIGRDNFDFEGSEDQKNFAAWTGEKA
NT seq 1545 nt   +upstreamnt  +downstreamnt
atggatacccgcgttgccaagaagaagcttggcctgaaggaacggtacgccgccatgacc
cgcggcctgggctgggagaccacgtatcagccgatggacaaggtctttccctacgacacc
tacgaaggcatcaagatccacgactgggacaagtggcaggacccgttccgcctgacgatg
gacgcctactggaagtaccagggggagaaggaaaagaagctgtatgcggtgatcgaagcc
ttcgcgcagaacaacggccagcttggcgtcagcgacgcccggtacatcaatgcactgaag
ctgttccttcagggcgtgacgccgcttgaatactgcgctcaccgtggctttgcacatgtt
ggccgtcagttcaccggcgagggcgcgcgcgtggccgcgcagatgcagtccatcgacgag
ctgcgtcactaccagaccgagacgcacgcgatctcgcactacaacaagtacttcaacggg
ctgcaccgggcgcaccattggttcgatcgtgtctggtacctgtcggtgccgaagtcgttc
ttcgaggatgcgtgcaccgccggtccgttcgagttcctgacggccgtgagcttttcgttc
gagtacgtgctgaccaacctgctgttcgtgcccttcatgtccggcgcggcgcacaacggc
gacatgagcaccgtcaccttcggtttctcggcgcagtccgacgagtcgcggcacatgacg
ctgggtatcgagtgcatcaagttcatgctcgagcaggattccggcaacgtgcccatcgtg
cagcgctggatcgacaagtggttctggcgcggttaccgcctgctgaccatcgtggcgatg
atgcaggactacatgctgcccaagcgcgtgatgagctggaaggaggcatgggaaatgtac
gccgagggcagcggtggtgcgctgttcaaggacctcgcgcgctacggcattcgcgaacca
cgcggctggaaggacgcctgcgagggcaaggaccatatcagccaccaggcgtgggccacc
ttctacaactacggggccgcggcgcctttccatacgtggctgccgcaggaagaggaaatg
cagtggctttcgcagaagtatcccgagagcttcgacaagctgtatcgcccgcgcttcgag
tactggcgcgagcgcgcggacgaaggccgccgcttctacaacaagacgctgccgatgctg
tgtaccacctgccaggtcccgatgttcttcacggagcccggtgatgccacgaagatctgc
taccgcgagaccagctactttggcaacaagtatcacttctgctccgaccactgccagcac
atcttcgaggatgagcccgagaagtacgtgcagagctggctgccggtgcaccaaatctac
caggggcactgcttccccgaaggcacggacccgacggcggaaggcttcgatccgctgaca
gccgtcctgcagtactacgaaatgaacatcggacgggacaacttcgacttcgagggatcg
gaggaccagaagaactttgccgcctggacaggagagaaagcatga

DBGET integrated database retrieval system