KEGG   Cupriavidus pinatubonensis JMP134: Reut_A1828
Entry
Reut_A1828        CDS       T00268                                 
Name
(GenBank) Short-chain dehydrogenase/reductase SDR
  KO
K07535  2-hydroxycyclohexanecarboxyl-CoA dehydrogenase [EC:1.1.1.-]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00362  Benzoate degradation
reu01100  Metabolic pathways
reu01120  Microbial metabolism in diverse environments
reu01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Reut_A1828
Enzymes [BR:reu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-
     Reut_A1828
SSDB
Motif
Pfam: adh_short_C2 adh_short KR NAD_binding_10 Sacchrp_dh_NADP Epimerase F420_oxidored ApbA PALP GDP_Man_Dehyd 3HCDH_N Shikimate_DH
Other DBs
NCBI-ProteinID: AAZ61193
UniProt: Q470J0
LinkDB
Position
1:2003551..2004351
AA seq 266 aa
MKNLEGKVAIVTGGTGGIGRGVALQLAARGALVVISGRSASKADAVLAELREAGGQGDFI
PGDVRVKADMDALAAETARRHGGIDIVVANAGGNDDEARRPEVRGPFGDIDVARVCAVVA
ENTAAKLLPVQSALPFLRERGGGAVVFVTSEGGRVPTPTQTAVATFAGGLISASKVLSKE
LARDRIRVNCVCVTVVRDSPSWKAAFERTDGVSDRHRKQYEKIIASSPLGVASPEDIGQV
VAFLASDESRYLTGATISPTGGLTIH
NT seq 801 nt   +upstreamnt  +downstreamnt
atgaagaatcttgaaggcaaggtggcgatcgtcaccggcggcaccggcgggatcggccgg
ggcgtggcactgcagctcgcggcgcgcggggcgctggtggtcatcagcggcaggagcgcg
tcaaaggcggacgcggtgctcgccgaactgcgcgaggcgggcggccagggcgatttcatc
cccggcgacgtccgcgtgaaggccgacatggatgcgctcgccgccgagaccgcgcgccgc
cacggcggcatcgatatcgtggtcgccaatgccggcggcaacgacgacgaggcgcgccgc
ccggaagtgcgcgggccgtttggcgatatcgacgtcgcgcgcgtctgcgccgtggtggcg
gagaacaccgccgcgaagctgctgccggtgcagtcggccctgcccttcctgcgcgagcgc
ggcggcggcgcggtggtcttcgtgacctcggaaggtgggcgcgtgccgacgccgacgcag
accgcggtggccacctttgccggcggcctgatcagcgcaagcaaggtgctatcgaaggaa
ctcgcgcgcgaccgcatccgcgtgaactgtgtatgcgtgacggtggtgcgcgacagtccc
tcctggaaggccgcgttcgagcgcaccgatggcgtgtcggaccggcaccgcaagcagtac
gagaaaatcatcgccagcagcccgctcggcgtggcaagcccggaggatatcggccaggtg
gtggctttcctcgcctccgacgagtcgcgctacctgactggggcgaccatcagcccgacc
ggcgggctgacgattcactga

KEGG   Cupriavidus pinatubonensis JMP134: Reut_B3915
Entry
Reut_B3915        CDS       T00268                                 
Name
(GenBank) 2-hydroxycyclohexane-1-carbonyl-CoA dehydrogenase
  KO
K07535  2-hydroxycyclohexanecarboxyl-CoA dehydrogenase [EC:1.1.1.-]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00362  Benzoate degradation
reu01100  Metabolic pathways
reu01120  Microbial metabolism in diverse environments
reu01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Reut_B3915
Enzymes [BR:reu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-
     Reut_B3915
SSDB
Motif
Pfam: adh_short_C2 adh_short KR Epimerase 3Beta_HSD Polysacc_synt_2 3HCDH_N Glyco_transf_4 GDP_Man_Dehyd
Other DBs
NCBI-ProteinID: AAZ63272
UniProt: Q46UB2
LinkDB
Position
2:546781..547548
AA seq 255 aa
MQGLKGKTVIVTGGGGGIGGATCLRFAREGAAVAVLDLSAEAARKVADRIAETGGKALAI
ACDITDRASVDLAVAAVREGLGPVDVLVNNAGWDVFRPFTKTEPAQWERLIAINLTGALH
MHHAVLPGMVERKQGRIVNIASDAARVGSSGEAVYAACKGGLVSFSKTIAREHARHGITV
NVVCPGPTQTALFEDYKQGAGNPEKLMEAFTRSIPLGRIGQPDDLPGAITFFASDDAAFI
TGQVLSVSGGLTMNG
NT seq 768 nt   +upstreamnt  +downstreamnt
atgcagggattgaaaggcaaaacggtcatcgtgactggcggtggtggtggtatcggcggc
gcaacatgtttgcgctttgcgcgcgaaggcgcggcggtggcagtgctcgacctcagtgcg
gaggcggcgcggaaggtggcggaccgtattgccgaaactggcggcaaggcgctggcaatc
gcttgcgacatcacggaccgcgccagcgtggacctggccgtcgccgcagtgcgggaaggg
ctggggcccgtcgatgtcctcgtcaataacgcgggttgggacgtgttccggcccttcacc
aagacggagccggcgcaatgggagcgcctgatcgccatcaacctgaccggcgcgctgcat
atgcatcacgcggtgttgcccggcatggtggagcgcaagcagggccgcatcgtcaatatc
gcgtccgacgcggcgcgcgtgggctcgtccggcgaagccgtctatgccgcgtgcaagggc
gggctggtgtcgttctcgaagaccatcgcacgcgaacatgcgcgccacggcatcaccgtc
aacgtggtgtgcccggggccgacgcagaccgcgctgttcgaagactacaagcagggcgcg
ggcaaccccgaaaagctcatggaagcgttcacgcgttcgatcccgcttggccgcatcggc
cagcccgacgacctgccgggcgccattaccttctttgccagcgacgacgcggcattcatc
accgggcaggtgctcagcgtgtccggcggcctgaccatgaacggctga

KEGG   Cupriavidus pinatubonensis JMP134: Reut_C6108
Entry
Reut_C6108        CDS       T00268                                 
Name
(GenBank) Short-chain dehydrogenase/reductase SDR
  KO
K07535  2-hydroxycyclohexanecarboxyl-CoA dehydrogenase [EC:1.1.1.-]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00362  Benzoate degradation
reu01100  Metabolic pathways
reu01120  Microbial metabolism in diverse environments
reu01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Reut_C6108
Enzymes [BR:reu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-
     Reut_C6108
SSDB
Motif
Pfam: adh_short_C2 adh_short KR Epimerase Polysacc_synt_2 Sacchrp_dh_NADP GDP_Man_Dehyd TrkA_N 3HCDH_N 3Beta_HSD RmlD_sub_bind NAD_binding_10 Methyltr_RsmB-F NAD_binding_7 F420_oxidored NmrA 2-Hacid_dh_C
Other DBs
NCBI-ProteinID: AAZ65433
UniProt: Q46N42
LinkDB
Position
mega:complement(250432..251199)
AA seq 255 aa
MRDLDNKVVVVTGAAGGIGTAICRRFVDAGARVVAVDKDEDALQRLAEALRPLNAQLALL
PLDITNHERVVSRIGSIAESLGGIDALVNNAGWDLPVQFLESSPEFWNKVIAINLVGPLN
LHHAVLPHMISRGGGMVVNIASDAGRVGSSGEAVYSACKGGIIAFTKTIARECANHNIRV
NTVCPGPTDTALLQSFGGDGEYGKKLYEGLKRAIPLKRLGKPEDVAGIVVFLSSPEAGFI
TGQTISVSGGLTMHG
NT seq 768 nt   +upstreamnt  +downstreamnt
atgcgagatctcgacaacaaagtggtggtggttacaggcgcggctggcggaatcggtact
gcaatttgtcggcgcttcgtcgatgccggggccagggtggtagcggtagacaaggatgag
gatgcgctgcaacggcttgccgaggcactccggcctctcaacgcccaactggcattgctc
ccgctcgatattaccaaccacgagcgggtcgtcagccggatcggttcgatcgcggagagc
ctgggcggtatcgatgctctggtcaacaatgcgggatgggatctgccggtgcaattcctt
gagagttcgccggaattctggaacaaggtcatcgccatcaatctggtcggtcctttgaac
cttcaccatgccgtgctgccgcacatgatatcgagaggagggggcatggtggtcaatatc
gcctcggatgccggccgcgtgggatcttcgggggaggccgtctattccgcatgcaagggc
gggatcatcgctttcacgaagacgattgcccgcgaatgtgccaatcacaatatccgtgtc
aatacggtctgtccggggcccacggacaccgcgcttctgcagtcatttggcggcgatggc
gaatatgggaagaagctctatgaagggctgaagcgcgcgatcccattgaagcgtctgggc
aagccggaagacgttgccggaatcgtcgtctttctctccagcccggaagccgggttcatc
actggccagaccattagcgtatctggcggtctcaccatgcacggttaa

DBGET integrated database retrieval system