KEGG   Cupriavidus pinatubonensis JMP134: Reut_A1952
Entry
Reut_A1952        CDS       T00268                                 
Name
(GenBank) Haloacid dehalogenase, type II:HAD-superfamily hydrolase, subfamily IA, variant 2
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00361  Chlorocyclohexane and chlorobenzene degradation
reu00625  Chloroalkane and chloroalkene degradation
reu01100  Metabolic pathways
reu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Reut_A1952
   00361 Chlorocyclohexane and chlorobenzene degradation
    Reut_A1952
Enzymes [BR:reu01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     Reut_A1952
SSDB
Motif
Pfam: HAD_2 Hydrolase HAD
Other DBs
NCBI-ProteinID: AAZ61316
UniProt: Q46ZW7
LinkDB
Position
1:complement(2138821..2139522)
AA seq 233 aa
MTKIRAVVFDAYGTLFDVYSVTARAEQLFPGKGEALALLWRERQIDYTRVRSMASPDGKY
YKPFWALTVDSLRYAAERLRVTLDEATEAQLLKEYACLSAFPENLGALKRLRRAGLPLGI
LSNGNAEMLDISVKSAGMHGLFDHVLSVDAVRQYKTAPAAYALGPKAFDLPAEDILFVSS
NGWDACGATWFGYTTFWINRAGHPAERLDVAPSGTGHDMNDLLDFVRAKGVEI
NT seq 702 nt   +upstreamnt  +downstreamnt
atgaccaagatccgcgcagtcgtcttcgacgcctacggcacgctgttcgacgtgtattcc
gtcacggcgcgcgcggaacagttgttcccgggcaagggtgaggcactggcattgctgtgg
cgcgagcgccagatcgactacacccgcgttcgcagcatggcctcgcccgacggcaagtac
tacaagccgttctgggccctgacggtggattcgctgcgctacgccgcagagcggctgcgc
gtgacgctggacgaggcgaccgaggcgcaattgcttaaggaatacgcctgcctgtccgcg
ttcccggagaacctgggtgcgctcaagcgactgcgacgcgcgggcctgccgctcggcatc
ctgtccaacggcaatgccgagatgctggacatttcggtcaagagtgccggcatgcacggg
ctgtttgaccacgtgctgtccgtggatgccgtgcgccagtacaagacggcaccggcggcc
tatgcgctcgggccgaaggcattcgacctgccggcagaagacatcctctttgtctcgtcg
aatgggtgggatgcctgcggcgcgacctggtttggctacaccacgttctggatcaaccgt
gccggccacccggcggagcgccttgacgtagcgccctccggcaccgggcacgatatgaac
gacctgctcgatttcgtccgcgccaaaggcgtggaaatctga

KEGG   Cupriavidus pinatubonensis JMP134: Reut_B5659
Entry
Reut_B5659        CDS       T00268                                 
Name
(GenBank) Haloacid dehalogenase, type II:HAD-superfamily hydrolase, subfamily IA, variant 2
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00361  Chlorocyclohexane and chlorobenzene degradation
reu00625  Chloroalkane and chloroalkene degradation
reu01100  Metabolic pathways
reu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Reut_B5659
   00361 Chlorocyclohexane and chlorobenzene degradation
    Reut_B5659
Enzymes [BR:reu01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     Reut_B5659
SSDB
Motif
Pfam: HAD_2 Hydrolase
Other DBs
NCBI-ProteinID: AAZ65004
UniProt: Q46PD0
LinkDB
Position
2:2487406..2488134
AA seq 242 aa
MKLTDFKVLTFDCYGTLIDWETGIYNALVPLLEKAGYAGKSRDEILENYARHEADQELMT
PGLAYTALLAIVYRRLANEWNVGVTNEECNIFGASVPDWPEFPDSVEALRYLKQHYKLVI
LSNVDRLSFRSSNARLGVEFDAIYTAQDIGSYKPSPKNFDYMLGRLSRDFGLEKKDILHT
AQSLFHDHAPANDFGLASAWIDRRHADRGWGATMPPPGTPKFDFRFESMAALAEAHKAAL
KA
NT seq 729 nt   +upstreamnt  +downstreamnt
atgaaactgacggacttcaaggtactgaccttcgactgctatggcaccctcatcgactgg
gagacgggcatttacaacgccctggtaccgctgctcgaaaaggctggctatgccggcaag
agccgcgatgagatcctggagaactacgccaggcatgaggccgaccaggaactgatgacg
ccgggcctggcctacacggcgctgctggcgatcgtctatcgtcgcctggcgaatgaatgg
aacgtcggcgtgaccaacgaggaatgcaatatctttggtgcgtccgttcccgactggccc
gagttcccggactcggtcgaagcgctgcgttatctgaagcaacactacaagctcgtcatc
ctgtccaacgtcgaccggctgtcgttccgcagcagcaatgcgcgactcggcgtcgagttc
gacgctatctacacggcgcaggacattggctcgtacaagccgagcccgaagaacttcgac
tacatgctgggtcgtctgagccgagacttcggactggaaaagaaggacatcctgcatacg
gcgcaaagcctgttccatgaccacgcgccggcaaacgacttcggcctggcatccgcatgg
atcgatcgccgccatgccgacaggggttggggtgcgacgatgcctcctccgggcaccccg
aagttcgatttccgcttcgagagcatggccgcgctggcagaagctcacaaggccgcgctg
aaagcctga

KEGG   Cupriavidus pinatubonensis JMP134: Reut_B5662
Entry
Reut_B5662        CDS       T00268                                 
Name
(GenBank) Haloacid dehalogenase, type II:HAD-superfamily hydrolase, subfamily IA, variant 2
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00361  Chlorocyclohexane and chlorobenzene degradation
reu00625  Chloroalkane and chloroalkene degradation
reu01100  Metabolic pathways
reu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Reut_B5662
   00361 Chlorocyclohexane and chlorobenzene degradation
    Reut_B5662
Enzymes [BR:reu01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     Reut_B5662
SSDB
Motif
Pfam: HAD_2 Terminase_4
Other DBs
NCBI-ProteinID: AAZ65007
UniProt: Q46PC7
LinkDB
Position
2:complement(2491537..2492280)
AA seq 247 aa
MPRDTLVSHRQSVDIGGKFSGKTVLTLDVYGTLIDWERGICDALGPILRGHGLSTSEDEM
LERYATHESALEAGPYLTYREILEESLLRIAADLGFTPSEYELDIFSHSVGDWPAFADSR
AALVALQKRFRLAVITNGDDEFFSLSNKHLKIQFDYVVTAQQARSYKPSLNNFHVALGRI
DAPRSQILHVAQSLYHDHVPAQALGLQTVWINRRRGKPGFGAVPKAEAVPDAEFDDMRAF
ADAMLER
NT seq 744 nt   +upstreamnt  +downstreamnt
atgccccgagacacgttagtcagtcaccgacaatcggtagatattggcggaaagttttcc
ggcaagacggtgctgacgttagacgtctatggcacgctgatcgactgggagcggggcatt
tgcgatgcattgggaccaatcctgaggggccacggattgtcgacgagcgaagacgagatg
ctggagcggtacgcgacgcatgagtccgcgctggaagcaggcccctacctgacatatcgg
gaaattctggaggagtcgctgctgcgcattgcggcagatcttggattcactccctcggaa
tacgaactcgacatcttttcgcattcggtcggtgactggccggcctttgccgattctcgg
gccgcactcgtcgcgcttcagaagcgttttcggctggccgtcatcacgaatggtgacgac
gaattcttctcgctttccaacaagcacctgaagatccagttcgactacgttgtcacggct
cagcaggcccgcagctacaagccgtcgttgaacaacttccatgtggcgcttggccggatc
gacgcaccgcgatcgcagatcctgcatgtcgcgcaaagtctgtatcacgaccatgtcccg
gcccaggcgctgggcctgcagactgtttggatcaaccgacgacgcggcaagcccggtttt
ggcgccgttccgaaggccgaagccgtacctgacgccgaattcgacgacatgcgagccttc
gccgacgcgatgctggaacggtag

DBGET integrated database retrieval system