Cupriavidus pinatubonensis JMP134: Reut_A2081 Help Entry Reut_A2081        CDS       T00268                                  Name (GenBank) RNA-binding protein Hfq   KO K03666   host factor-I protein Organism reu  Cupriavidus pinatubonensis JMP134 Pathway reu02024   Quorum sensing reu03018   RNA degradation Brite KEGG Orthology (KO) [BR:reu00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     Reut_A2081  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     Reut_A2081  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:reu03019]     Reut_A2081    03036 Chromosome and associated proteins [BR:reu03036]     Reut_A2081 Messenger RNA biogenesis [BR:reu03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      Reut_A2081 Chromosome and associated proteins [BR:reu03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     Reut_A2081 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 SRP14 Motif Other DBs NCBI-ProteinID:  AAZ61445 UniProt:  Q46ZI8 LinkDB All DBs Position 1:complement(2288440..2288679) Genome browser AA seq 79 aa AA seqDB search MSNKGQLLQDPFLNALRKEHVPVSIYLVNGIKLQGNIESFDQYVVLLRNTVTQMVYKHAI STVVPARAVNFRVDDSAEG NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcaacaaagggcaactgctacaagacccgttcctgaacgcgctgcgcaaagagcac gtgccggtttccatctatctggtcaatggcatcaagctgcaaggcaatatcgaatcgttc gaccaatatgtcgtgctcctgcgtaacaccgtgacgcagatggtctacaagcatgcgatt tccaccgtcgtcccggctcgcgcggtcaatttccgcgtggatgattccgccgagggctga

DBGET integrated database retrieval system