KEGG   Cupriavidus pinatubonensis JMP134: Reut_A2331
Entry
Reut_A2331        CDS       T00268                                 
Name
(GenBank) aconitase
  KO
K01681  aconitate hydratase [EC:4.2.1.3]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00020  Citrate cycle (TCA cycle)
reu00630  Glyoxylate and dicarboxylate metabolism
reu01100  Metabolic pathways
reu01110  Biosynthesis of secondary metabolites
reu01120  Microbial metabolism in diverse environments
reu01200  Carbon metabolism
reu01210  2-Oxocarboxylic acid metabolism
reu01230  Biosynthesis of amino acids
Module
reu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
reu_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
reu_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Reut_A2331
   00630 Glyoxylate and dicarboxylate metabolism
    Reut_A2331
Enzymes [BR:reu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.3  aconitate hydratase
     Reut_A2331
SSDB
Motif
Pfam: Aconitase Aconitase_C
Other DBs
NCBI-ProteinID: AAZ61693
UniProt: Q46YU0
LinkDB
Position
1:2570299..2573004
AA seq 901 aa
MPYNLNKTLKEFKIGSSGNGQFYSLPQLGEELNVAIERLPVSIRVVLESVLRNCDGKKVT
EEHVRQLANWKPNAERVDEIPFVVARVVLQDFTGVPLLADLAAMRNVAEKMGKNPKQIEP
LVPVDLVVDHSVQVDHFREKKALDLNMQLEFQRNNERYQFMKWGMQAFDTFGVVQPGFGI
VHQVNLEYLARGVHKKDGVYYPDTLVGTDSHTTMINGIGVVGWGVGGIEAEAGMLGQPVY
FLTPDVVGVELTGRLREGVTATDLVLTITEMLRKEKVVGKFVEFFGEGTASLALPDRATI
GNMAPEYGATMGFFPVDEKTIDYFKGTGRTEEEIAAFEGYFRAQNMFGIPKSGEIDYSNV
VKLDLGTVAPSLAGPKRPQDRIEIGNVKSTFSSLFSKPVAENGFNKEPAELDRTYQTTDG
IDVKNGDVLIAAITSCTNTSNPSVLLGAGLLAKKAVEAGLTVAPHIKTSLAPGSRVVTEY
LTAAGLLPYLEKLGFGVTAYGCTTCIGNAGDLTPELNEAIVTNDLVAAAVLSGNRNFEAR
IHPNIRANFLASPPLVVAYAIAGNVTRDLMTEPVGKGKGGKDIWLGDIWPSSEEIHALMK
FAMDAKTFKGNYEQVKKPSKLWGAIKGTKGQVYDWPASTYIAEPPFFQDFSMEPSGATAS
VRGARALGVFGDSVTTDHISPAGSIKDTSPAGKYLLSHGVLKADFNSYGSRRGNHEVMMR
GTFANVRIKNLMIPPKADGSRVEGGLTIHQPTGEEMSIYDAAMKYIAEGTPTMVFGGEEY
GTGSSRDWAAKGTQLLGVKAVIARSFERIHRSNLVGMGVLPLQFKGTDSAQTLGITGNET
FDIEGIEGDLRPQQDLVLVINRANGDVQRVPVLLRIDTPIEVDYYNHGGILPFVLRQLLA
A
NT seq 2706 nt   +upstreamnt  +downstreamnt
atgccctacaacctcaataagacgctaaaagaattcaagatcggctcttcaggcaacggc
cagttctattccctcccccaactgggcgaggaactgaacgtggcgatcgaacgcctgccg
gtgtcgatccgcgtggtgctcgaatcggtgctgcgcaattgcgacggcaagaaggtcacc
gaggaacatgtccgccagcttgccaactggaagccgaacgcggaacgcgtcgacgagatt
ccgttcgtggtggcgcgtgtcgtgctgcaggactttaccggcgtgccgctgctggccgac
ctcgccgccatgcgtaacgtggccgagaagatgggcaagaaccccaagcagatcgagccg
ctggtgccagtggacctggtcgtcgatcactcggtccaggtcgaccacttccgcgaaaag
aaggcgctcgacctgaacatgcaactggaattccagcgcaacaacgagcgataccagttc
atgaagtggggcatgcaggcgtttgacacctttggcgtggtgcagccgggcttcggcatc
gtgcaccaggtcaatctcgaatatctcgcgcgcggcgtccataagaaggacggcgtgtac
taccccgacaccctggtcggcaccgatagccacaccaccatgatcaacggcatcggcgtg
gtgggctggggcgttggcggcattgaagcggaagccggcatgctgggccagccggtgtac
ttcctgacgccggacgtggtgggcgtggaactgaccggccgcctgcgcgagggcgtgact
gcgaccgacctcgtgctgaccatcaccgagatgctgcgcaaggaaaaggtcgtcggcaag
ttcgtcgagttcttcggcgaaggcacggccagcctggcgctgccggaccgcgccacgatc
ggcaacatggcgcccgagtacggcgccaccatgggcttcttcccggtggacgagaagacc
atcgattacttcaagggcaccggccgcacggaagaggaaatcgccgcgttcgaaggctat
ttccgagcgcaaaacatgttcggtatccccaagtccggcgagatcgactacagcaatgtg
gtcaagctggacctcggcaccgtcgcgccgtcgctggcaggcccgaagcgtccgcaggac
cgcatcgagatcggcaacgtcaagagcacgttcagctcgctgttcagcaagcccgtggcc
gagaacggcttcaacaaggagccggccgaactcgatcgcacctaccagaccacggacggc
atcgacgtcaagaacggcgacgtgctgatcgccgccatcacgtcctgcaccaacacgtcc
aatccgagcgtgctgcttggcgccggcttgctggccaagaaggccgtggaagccgggctg
acggtggcgccgcacatcaagacgtcgctggcgcccggaagccgcgtggtgaccgagtac
ctgacggccgccggcctgctgccgtacctcgaaaagcttggcttcggcgtgaccgcctac
ggctgcaccacgtgcatcggcaacgcgggcgacctgacgccggaactgaacgaggccatc
gtcacgaacgacctggtcgcggccgccgtgctgtcgggcaaccgcaatttcgaggcccgc
atccatccgaatatccgtgccaacttcctggcttcgccgccgctggtggtggcctacgcc
atcgcaggcaatgtcacgcgcgacctgatgaccgagccggtcggcaagggcaagggcggc
aaggacatctggctcggcgacatctggccgagctcggaggaaatccacgcgctgatgaag
ttcgcgatggacgccaagacgttcaagggcaactacgagcaggtcaagaagccgagcaag
ctgtggggcgcgatcaagggcaccaagggccaggtctacgactggcccgcgtcgacctac
atcgccgagccgccgttcttccaggacttcagcatggagccgtccggcgccactgcgagc
gtgcgcggcgcacgcgcgctcggcgtcttcggcgattccgtgacgaccgaccacatctcc
ccggccggttcgatcaaggacacctcccctgccggcaagtacctgctgtcgcatggcgtg
ctcaaggcggacttcaacagctacggttcgcgccgcggcaaccatgaggtgatgatgcgc
ggcacgttcgccaacgtgcgcatcaagaacctgatgatcccgcccaaggccgacggctcg
cgcgtcgaaggcggcctgacgatccaccagccgaccggcgaggaaatgtcgatctacgac
gccgccatgaagtacatcgccgaaggcacgccgacgatggtgttcggcggcgaggaatac
ggcaccggctcgtcgcgcgactgggcggccaagggtacgcagctgctgggcgtgaaggcc
gtgatcgcgcgcagcttcgagcgcatccaccgttccaacctggtcggcatgggcgtgctg
ccgctgcagttcaagggcaccgacagcgcgcagacgctgggcatcacgggcaacgagacc
ttcgacatcgagggcatcgagggggatctcaggccgcagcaggacctggtgctggtgatc
aaccgtgccaatggcgacgtgcagcgcgtgccggtgctgctgcgcatcgacacgccgatc
gaagtcgattactacaaccacggcggcatcctgccgttcgtgctgcgccagctgctggcc
gcctga

KEGG   Cupriavidus pinatubonensis JMP134: Reut_B3464
Entry
Reut_B3464        CDS       T00268                                 
Name
(GenBank) aconitase
  KO
K01682  aconitate hydratase 2 / 2-methylisocitrate dehydratase [EC:4.2.1.3 4.2.1.99]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00020  Citrate cycle (TCA cycle)
reu00630  Glyoxylate and dicarboxylate metabolism
reu00640  Propanoate metabolism
reu01100  Metabolic pathways
reu01110  Biosynthesis of secondary metabolites
reu01120  Microbial metabolism in diverse environments
reu01200  Carbon metabolism
reu01210  2-Oxocarboxylic acid metabolism
reu01230  Biosynthesis of amino acids
Module
reu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
reu_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
reu_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Reut_B3464
   00630 Glyoxylate and dicarboxylate metabolism
    Reut_B3464
   00640 Propanoate metabolism
    Reut_B3464
Enzymes [BR:reu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.3  aconitate hydratase
     Reut_B3464
    4.2.1.99  2-methylisocitrate dehydratase
     Reut_B3464
SSDB
Motif
Pfam: Aconitase_2_N Aconitase Aconitase_B_N Ketoacyl-synt_C
Other DBs
NCBI-ProteinID: AAZ62822
UniProt: Q46VK6
LinkDB
Position
2:127..2562
AA seq 811 aa
MPAGVDDAAKVKAAFLAAVAQGKDSCKLISRAKATELLGTMLGGYNIAPLISLLADAEVG
TVAADALKKTLLMFDAFHDVKELADKGNANAKAVLQSWADAEWFTSRPEVPQSLTITVFK
VPGETNTDDLSPAPDATTRPDIPMHALAMLKNKREGAAFQPEEDGKRGPIKFIQSLAEKG
NLVAYVGDVVGTGSSRKSATNSVLWFTGEDIPFIPNKRFGGVCLGSKIAPIFYNTMEDAG
ALPIELDVSKMEMGDVVELRPYEGKALKNGEVIAEFKVKSDVLFDEVRAGGRIPLIVGRG
LTAKAREALGLAPSTLFRLPQNPADTGKGFTLAQKMVGRACGLPEGKGIRPGTYCEPKMT
SVGSQDTTGPMTRDELKDLACLGFSADLVMQSFCHTAAYPKPVDVKTHHTLPEFISTRGG
ISLRPGDGVIHSWLNRMLLPDTVGTGGDSHTRFPIGISFPAGSGLVAFAAATGVMPLDMP
ESVLVRFKGKMQPGVTLRDLVNAIPLYAIKQGLLTVAKQGKTNIFSGRILEIEGLPDLKV
EQAFELSDASAERSAAGCSVHLNKEPIIEYINSNITLLKWMIAQGYQDPRSLQRRIEAMQ
AWLAKPELLAPDADAEYAAVIEIDLADVHEPIVACPNDPDDVKTLSEVAGAKIDEVFIGS
CMTNIGHFRAASKLLEGKRDIPVKLWVAPPTKMDQKQLTEEGHYGVFGTAGARTEMPGCS
LCMGNQAQVREGATVMSTSTRNFPNRLGKNTNVYLGSAELAAICSRLGKIPSKEEYMADI
GVINQNGDKIYKYMNFDQIEDFKEVADGVNL
NT seq 2436 nt   +upstreamnt  +downstreamnt
gtgcctgccggtgtggatgacgccgccaaggtcaaggctgccttcctggccgccgttgcc
cagggcaaggacagctgcaagctgatctcgcgcgccaaggcgaccgaactgctgggcacc
atgctcggcggctacaacatcgccccgctgatttcgctgctggccgatgccgaagtcggc
accgtcgccgctgatgcgctcaagaagaccctgctgatgttcgacgccttccacgacgtc
aaggaactcgcagacaagggcaacgccaacgccaaggccgtgctgcagagctgggccgac
gccgagtggttcacgagccgcccggaagtgccgcagagcctgaccatcaccgtgttcaag
gtgccgggcgaaaccaacaccgacgacctgtcgccggctccggacgccaccacgcgcccg
gacatcccgatgcacgcgctggccatgctgaagaacaagcgtgaaggcgcggcgttccag
cccgaagaagacggcaagcgcggcccgatcaagttcatccagtcgctggccgagaagggc
aatcttgttgcctacgtcggcgacgtggtcggtaccggttcgagccgcaagtcggccact
aactcggtgctgtggttcaccggcgaagacatccccttcatcccgaacaagcgctttggc
ggcgtgtgcctgggcagcaagatcgccccgatcttctacaacactatggaagacgccggc
gcgctgccgatcgagctggacgtgtcgaagatggaaatgggcgacgtggtggaactgcgc
ccgtacgaaggcaaggccctgaagaacggtgaagtgatcgccgagttcaaggtcaagtcc
gacgtgctgttcgacgaagtccgcgccggcggccgcattccgctgatcgtcggccgtggc
ctgaccgccaaggcccgcgaagcgttgggcctggccccgtcgacgctgttccgcctgccg
cagaacccggccgacactggcaagggcttcacgctggcccagaagatggtcggccgcgcc
tgcggcctgccggaaggcaagggcatccgtccgggcacgtactgcgaaccgaagatgacc
tcggtgggctcgcaagacaccaccggcccgatgacccgcgacgagctgaaggacctggcc
tgcctgggcttctcggccgacctggtgatgcagtcgttctgccacactgcggcgtatccg
aagccggtcgacgtcaagacccaccacacgctgcccgaattcatttcgacccgcggcggt
atctcgctgcgtccgggcgacggcgtgatccactcgtggctgaaccgcatgctgctgccc
gacaccgtcggcacgggcggcgactcgcacacccgcttcccgatcggcatcagcttcccg
gccggttcgggcctggtcgcctttgccgctgccaccggcgtgatgccgctggacatgccg
gaatcggtgctggtccgcttcaagggcaagatgcagcctggcgtgaccctgcgtgacctg
gtcaacgcgatcccgctgtacgcaatcaagcaaggcctgctgaccgtggccaagcaaggc
aagacgaacatcttctcgggccgcatcctcgaaatcgaaggcctgcctgacctgaaggtc
gagcaagcgttcgaactgtcagatgcttccgccgagcgttcggccgccggttgctcggtg
cacctgaacaaggaaccgatcatcgaatacatcaacagcaacatcacgctgctgaagtgg
atgatcgcccagggctaccaggacccgcgcagcctgcagcgccgcatcgaagccatgcaa
gcatggctggccaagccggaactgctggctccggatgccgacgccgaatacgctgccgtg
atcgagatcgacctggccgacgtgcatgagccgatcgttgcctgcccgaacgacccggat
gacgtgaagacgctgtcggaagttgccggcgccaagatcgacgaagtgttcatcggttcg
tgcatgaccaacatcggccacttccgtgccgcttcgaagctgctggaaggcaagcgcgac
atcccggtcaagctgtgggtggccccgccgaccaagatggaccagaagcagctgaccgaa
gaaggccactacggcgtgttcggcacggctggtgcacgtaccgaaatgccgggctgctcg
ctgtgcatgggtaaccaggcacaagtgcgcgaaggcgccacggtgatgtcgacctcgacc
cgcaacttcccgaaccgtctgggcaagaacaccaacgtgtacctgggttcggccgaactg
gccgcgatctgctcgcgtctgggcaagatcccttcgaaggaagagtacatggccgatatt
ggcgtcattaaccagaatggcgacaagatctacaagtacatgaacttcgaccagatcgag
gacttcaaggaagtcgctgatggcgtgaacctgtaa

DBGET integrated database retrieval system