KEGG   Cupriavidus pinatubonensis JMP134: Reut_B3579
Entry
Reut_B3579        CDS       T00268                                 
Name
(GenBank) Ferredoxin:Oxidoreductase FAD/NAD(P)-binding:Oxidoreductase FAD-binding region
  KO
K21607  tetrachlorobenzoquinone reductase [EC:1.1.1.404]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00361  Chlorocyclohexane and chlorobenzene degradation
reu01100  Metabolic pathways
reu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00361 Chlorocyclohexane and chlorobenzene degradation
    Reut_B3579
Enzymes [BR:reu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.404  tetrachlorobenzoquinone reductase
     Reut_B3579
SSDB
Motif
Pfam: Fer2 NAD_binding_1 Fer2_4 NAD_binding_6 Fer2_3
Other DBs
NCBI-ProteinID: AAZ62937
UniProt: Q46V97
LinkDB
Position
2:135407..136363
AA seq 318 aa
MSAHKTLTMRVQAMRYEARGIVSLELQDPDGATLPEYGPGAHIDLHLGNGLVRSYSLCGA
PEVRDRYTVGVLQDRNSRGGSRYVHEQLRVGATLNVSAPRNNFELDESAAHTVLVAGGIG
VTPIVCMARRLAELGRSFTLLYCARTRAEAAFVDSLSAYGDAVRFHFDDEAGAPPDMKAM
LAGQDAQTHLYCCGPGPMLNAFEAACEAHGYPNVHIERFAADPSTESVQEGEYVVQLSRT
GSLVKVPSGKSLLDALLEAGLDVEHSCREGVCGSCETAVLEGCPDHRDSVLSNSERASNK
TMMVCVSGCKGSRLVLDL
NT seq 957 nt   +upstreamnt  +downstreamnt
atgagtgcccacaagaccctgacgatgcgagtccaggccatgcgctacgaagcgcgcggc
attgtcagcctcgagctgcaagatcccgacggggccacgctgcccgaatacggtccgggc
gcccatatcgacctgcacctcggcaatggcctggtccgcagctactcgctgtgcggcgcg
ccggaagtccgcgaccgctacaccgtgggtgtcctgcaggaccgcaacagccgcggcggc
tcgcgctacgtgcatgagcaactgcgcgtcggcgccacgctgaacgtcagcgcgccgcgc
aacaacttcgaactcgatgaaagcgccgcgcacaccgtgctcgtcgccggcggcatcggc
gtcacgccgatcgtctgcatggcacgccgcctggccgagctgggccgttcgttcacgctg
ctgtactgcgcccgcacgcgcgccgaagcggcgttcgtcgattcgctgtcggcgtatggc
gacgcggtgcgtttccacttcgacgacgaagccggtgctccgcccgacatgaaggccatg
ctggccggccaggacgcgcagacgcacctgtactgctgcggccccggcccgatgctcaat
gcgttcgaagccgcgtgcgaggcgcacggctatccgaacgtccacatcgaacgctttgcc
gccgatccgtcgaccgagtcggtgcaggaaggcgaatacgtcgtgcagctgtcgcgcacg
ggctccctcgtcaaggtgccgtcgggcaagtcgctgctcgacgcactgctcgaagccggc
ctggacgtcgagcacagctgccgcgaaggcgtgtgcggttcgtgcgagaccgctgtgctg
gaaggctgccccgaccaccgcgacagcgtgctcagcaacagcgagcgcgcctccaacaag
accatgatggtctgcgtgtccggctgcaagggcagccggctggtgctggacctgtaa

KEGG   Cupriavidus pinatubonensis JMP134: Reut_B4797
Entry
Reut_B4797        CDS       T00268                                 
Name
(GenBank) Ferredoxin:Oxidoreductase FAD/NAD(P)-binding:Oxidoreductase FAD-binding region
  KO
K21607  tetrachlorobenzoquinone reductase [EC:1.1.1.404]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00361  Chlorocyclohexane and chlorobenzene degradation
reu01100  Metabolic pathways
reu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00361 Chlorocyclohexane and chlorobenzene degradation
    Reut_B4797
Enzymes [BR:reu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.404  tetrachlorobenzoquinone reductase
     Reut_B4797
SSDB
Motif
Pfam: Fer2 NAD_binding_1 NAD_binding_6 Fer2_3 Fer2_4
Other DBs
NCBI-ProteinID: AAZ64145
UniProt: Q46RT9
LinkDB
Position
2:1496869..1497837
AA seq 322 aa
MSNTDTLQVRVKSISWEADGILAFELRPEPPLRALPAFAAGAHIDLHLPNGLIRSYSLLN
AQCEPHRYVIGVNRDAQSRGGSRYLHETLRPGDVLTISPPRNNFPLDDSASLAVLVAGGI
GITPILGMIHRLRELGRPWRLHYAARTRKQAAFVETLEAMGMEPGGEVRLTFDREAGADR
LDVTAIAASLPEGAHIYCCGPVPMLEAFEQATASLPPGRVHREYFAARESAATDGGFTVE
LARSGRSIEIQPGRTILECLIAEGVEPMYSCQEGVCGTCEVRVLDGEPDHRDLVLNAEER
AANNRMMVCCSGAKTRKLVLDL
NT seq 969 nt   +upstreamnt  +downstreamnt
atgagcaataccgataccctgcaagtccgggtcaagtccatcagctgggaagccgacggc
atcctggctttcgagctgcggccggagccgccgttgcgtgccctgcccgcgtttgcggcg
ggcgcgcatatcgacctgcatctgccgaacggcctgattcgcagctattcgctgctgaac
gcgcagtgcgagccgcaccgctacgtgattggcgtcaaccgcgacgcgcagagccgcggt
ggctcgcgctatctgcacgagacgctgcgccccggcgacgtgctgaccatcagcccgccg
cgcaacaacttcccgctcgacgattcggcatcgctggcggtgctggtggccggcggcatc
ggcatcacgccgatcctcggcatgattcatcggctacgcgaactgggccggccgtggcgc
ctgcactatgccgcacgcacacgcaagcaggcagcatttgtcgagacgctggaggccatg
ggcatggagcccggtggcgaagtccggctgaccttcgaccgcgaagccggcgctgaccgc
ctcgacgtcacggccatcgccgcgagcctgcctgaaggcgcgcacatctactgctgcggg
ccggtgccgatgctcgaggccttcgagcaggccaccgcatcgctgccgcccgggcgcgtg
catcgcgagtacttcgccgcacgcgagtccgccgcgaccgacggcggcttcaccgtggaa
cttgcgcgcagcggccgcagcatcgagattcagccgggccggaccatcctggaatgcctg
atcgccgaaggtgtcgagcccatgtattcgtgccaggagggcgtgtgcggaacctgcgag
gtgcgtgtgctggacggtgagcccgatcaccgcgacctcgtgctgaacgctgaagaacgc
gccgccaacaaccggatgatggtgtgctgctccggcgcgaagacccgcaagctggtgctg
gatctgtag

KEGG   Cupriavidus pinatubonensis JMP134: Reut_B5777
Entry
Reut_B5777        CDS       T00268                                 
Name
(GenBank) Phthalate 4,5-dioxygenase
  KO
K21607  tetrachlorobenzoquinone reductase [EC:1.1.1.404]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00361  Chlorocyclohexane and chlorobenzene degradation
reu01100  Metabolic pathways
reu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00361 Chlorocyclohexane and chlorobenzene degradation
    Reut_B5777
Enzymes [BR:reu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.404  tetrachlorobenzoquinone reductase
     Reut_B5777
SSDB
Motif
Pfam: Fer2 NAD_binding_1 NAD_binding_6 Fer2_4 FAD_binding_6 Rpr2
Other DBs
NCBI-ProteinID: AAZ65120
UniProt: Q46P14
LinkDB
Position
2:complement(2601208..2602170)
AA seq 320 aa
MNDLPQFTGALLELRLESIQFLARDTLLYAFASPVGAALPPCEPGSHIGLHLPNGLVRQY
SLLEGGREPRRYQVGVKRDPKSRGGSSFMHEQLRPGAVIQVEPPRNNFPLNEEAEHSVLV
GGGIGITPILCMARRLKALGRSMTLVYSCRDRVDVAFLEELRSYENLHLHIDAEAGGVLD
IAEVVKAHPANTHFYCCGPGPMLSAFEAATAHLPAAQVHVEYFTAKQEAALDGGYTVELK
RSGKSLQVPGGKTILQVLKDAGVEVAHSCEEGVCGACETRVLSGIPDHRDAILSEPEKAA
NNTMMICCSGCKGERLVLDL
NT seq 963 nt   +upstreamnt  +downstreamnt
atgaacgacctgccccagttcacgggcgccctccttgagttgcgcctggagtcgattcaa
ttcctcgcccgcgacacgctgctctacgccttcgcgtctccggtgggcgccgcgctgccg
ccgtgcgagccgggttcccatatcggcttgcacctgcccaatggcctggtgcgccaatat
tcgctgctcgaaggcggccgcgagccgcggcgctaccaggtaggggtgaagcgcgacccc
aaaagccgcggcggttccagcttcatgcacgagcagttgcgccccggcgcggtgatccag
gtggagccgccgcgcaacaatttcccgctgaatgaagaggccgagcattcggtgctggtc
ggtggcggcatcggcatcacgccgatcctgtgcatggcgaggcgcctgaaggcgctgggc
cgctcgatgacactggtgtactcgtgccgcgaccgcgtcgacgtcgccttcctcgaggaa
ctgcgcagctacgagaacctgcacctgcacatcgacgcagaagcgggcggcgtgctcgac
atcgccgaagtagtgaaggcgcatccggccaacacgcacttctattgctgcggcccgggc
ccgatgctttcggccttcgaagcagccacggcccacctgcctgcggcgcaggtccacgtc
gagtatttcaccgcgaagcaggaagccgcgctggacggcggctacacggtcgaactgaag
cgcagcggcaaatctctgcaggtaccgggtggcaaaaccatcctgcaggtgctcaaggat
gccggcgtggaagtggcgcactcctgcgaggaaggcgtgtgcggcgcctgcgagacgcgc
gtgctatccggcattcccgatcaccgcgacgccatcctttccgaaccggagaaggcggcc
aacaacaccatgatgatctgctgctcgggttgcaagggcgagcggctggtcctcgatctg
taa

DBGET integrated database retrieval system