KEGG   Cupriavidus pinatubonensis JMP134: Reut_B3916
Entry
Reut_B3916        CDS       T00268                                 
Name
(GenBank) 1,4-Dihydroxy-2-naphthoate synthase
  KO
K07536  2-ketocyclohexanecarboxyl-CoA hydrolase [EC:3.1.2.-]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00362  Benzoate degradation
reu01100  Metabolic pathways
reu01120  Microbial metabolism in diverse environments
reu01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Reut_B3916
Enzymes [BR:reu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.-
     Reut_B3916
SSDB
Motif
Pfam: ECH_1 ECH_2 SDH_sah
Other DBs
NCBI-ProteinID: AAZ63273
UniProt: Q46UB1
LinkDB
Position
2:547597..548379
AA seq 260 aa
MQYEDILYEVRNGAAWITINRAEKMNAFRGRTCDELIHAINRAGYDREIGTIVLAGAGDK
AFCTGGDQSAHEGQYDGRGTIGLPMEELHNAIRDVPKPVIARVQGYAIGGGNVLCTICDF
TIASEKAVFGQVGPKVGSVDPGYGTAYLARVVGEKKAREIWYLCRRYPAAEALAMGLVNA
VVPHEQLDAEVQKWCDEILEKSPTAVAIAKRSFNMDTAHQSGIAGMGMYALKLYYDTEES
REGVKAFQEKRKPEFRKYAK
NT seq 783 nt   +upstreamnt  +downstreamnt
atgcaatacgaagacatcctctatgaagtccgcaacggcgcggcctggatcaccatcaat
cgcgcggagaagatgaatgccttccgcggccgcacgtgcgacgaactgatccacgcgatc
aatcgcgcgggctatgaccgcgagatcggcacaatcgtgttggccggcgctggcgacaag
gcgttctgcaccggcggcgaccagtccgcgcatgaagggcagtacgacgggcggggcacc
atcggcctgccgatggaagaactgcacaacgccattcgcgacgtgcccaaaccggtcatt
gcgcgagtacagggctatgccatcgggggcggcaatgtgctgtgcacgatctgcgatttc
accatcgcctccgaaaaggccgtgttcgggcaggtcgggccgaaggtcggctcggtcgat
cccggctatggcacggcctatctggcccgcgtcgtcggcgaaaagaaagcgcgcgaaatc
tggtacctgtgccgccgctatccggcagccgaagcgctggcgatgggcctcgtcaacgcc
gtggtgccgcacgagcagctcgatgccgaggtgcagaagtggtgcgacgagattcttgag
aagagcccgaccgcggtcgccatcgccaagcgctcgttcaacatggacaccgctcaccag
agtggcatcgccggcatgggcatgtatgcgctgaagctctattacgacaccgaggaatca
cgcgaaggcgtcaaggcattccaggaaaagcgcaagcccgaattccgcaagtacgcgaag
taa

KEGG   Cupriavidus pinatubonensis JMP134: Reut_C6107
Entry
Reut_C6107        CDS       T00268                                 
Name
(GenBank) 1,4-Dihydroxy-2-naphthoate synthase
  KO
K07536  2-ketocyclohexanecarboxyl-CoA hydrolase [EC:3.1.2.-]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00362  Benzoate degradation
reu01100  Metabolic pathways
reu01120  Microbial metabolism in diverse environments
reu01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Reut_C6107
Enzymes [BR:reu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.-
     Reut_C6107
SSDB
Motif
Pfam: ECH_1 ECH_2 SDH_sah
Other DBs
NCBI-ProteinID: AAZ65432
UniProt: Q46N43
LinkDB
Position
mega:complement(249623..250426)
AA seq 267 aa
MTQYTDILFDRKDGVARITINRPERYNAFRGHTCEELIDAFNTAGWDPSIGVIVLTGAGD
KAFCTGGDQSAHDGKYDGRGVVGLPVEELQGVIREVPKPVIARVNGYAIGGGNVLVTCCD
LAIASDTAIFGQVGPKVGSVDPGFGTAFLSRVVGEKKAREIWFLCRRYPAKQALEMGLVN
RVVDPAELDAEVAIWCNEILGMSPTAIAIAKRSFNADSDSIRGIGGLGMQALALYYQTAE
SREGVSAFLEKRRPQFRGIVNGHEGDA
NT seq 804 nt   +upstreamnt  +downstreamnt
atgacccaatacaccgacattttgttcgacaggaaggacggcgttgcacgcatcacgatc
aatcgtcccgagcgttataacgcattccgggggcatacctgcgaggagttgatcgatgcg
ttcaacacggcgggatgggatccttccattggcgtgattgtcctgaccggcgcgggagac
aaggccttctgtacgggcggagatcaatcggcgcatgatggcaagtatgacggcaggggc
gtggtggggctgcccgtggaggagttgcagggcgtgatccgcgaagtaccgaagcccgtc
attgcgcgtgtcaatggctatgcaatcggcggcggcaacgtactggtgacgtgctgcgat
cttgccatcgcatcggacaccgcgatcttcgggcaagtggggccgaaggtcggttcggtc
gacccgggcttcggcacggcattcctgtcgagagtcgtcggagaaaaaaaggcgcgggag
atctggttcctgtgtcgccgctatccggcaaaacaggcgctggagatgggactggtgaac
cgggtggttgatcctgcggaactcgatgcggaagtggctatctggtgcaacgagatcctg
ggcatgagcccgaccgcgattgccatcgccaagcgatccttcaatgccgattccgattcg
atccggggcattggcgggctcggcatgcaggccctggcgctctattatcagaccgccgaa
tcgcgcgagggcgtgtctgcattccttgagaagcgccggccgcagttccggggcattgtg
aacggccacgagggcgacgcgtaa

DBGET integrated database retrieval system