KEGG   Cupriavidus pinatubonensis JMP134: Reut_B4006
Entry
Reut_B4006        CDS       T00268                                 
Name
(GenBank) Aromatic-ring hydroxylase
  KO
K00481  p-hydroxybenzoate 3-monooxygenase [EC:1.14.13.2]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00362  Benzoate degradation
reu01100  Metabolic pathways
reu01120  Microbial metabolism in diverse environments
reu01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Reut_B4006
Enzymes [BR:reu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.2  4-hydroxybenzoate 3-monooxygenase
     Reut_B4006
SSDB
Motif
Pfam: FAD_binding_3 Pyr_redox_3 NAD_binding_8 Lycopene_cycl ApbA Pyr_redox_2 DAO FAD_binding_2 HI0933_like
Other DBs
NCBI-ProteinID: AAZ63362
UniProt: Q46U22
LinkDB
Position
2:645961..647148
AA seq 395 aa
MRTRVAIIGAGPAGLLLGHLLQRAGIDSVILEDCTQAHVEARIRAGVLEQGTVDLLEEAG
VAARLREQGMVHHGIDLLFDGQRHRIDLSGLTGGRAITVYGQHEVVRDLIAARQACGAPL
LFEVSQVALHGLDTQSPSLSFEHGGQRHVLACDFIAGCDGSHGVSRHAVPAGALQVFERS
YPFAWLGILASAAPAAQELIYASHARGFALFSMRSPEITRLYLQCRPDEDLAGWTDRRIW
DELHARLETGDGWHLNEGPVLQKGITPMRSLVTEPMQYGRLFLAGDAAHIVPPTGAKGMN
LAVADVRNLAHALVTHYRHGRDDLLAGYSSACLARVWRAEHFSWWMTSLLHRFDDHTPFT
ARLQHAELAYVCASQAASRMLAENYVGLPFAPLPA
NT seq 1188 nt   +upstreamnt  +downstreamnt
atgcgcacccgggtcgcaatcatcggcgcgggcccggccgggctgctgctcggtcatttg
ctgcagcgggccggtattgattccgtcattctcgaagactgtacccaggcacatgtcgag
gcgcgcatacgcgccggggtgctcgaacaaggtactgtcgacctgctggaagaggctggc
gtggccgcgcgcctgcgcgagcaaggcatggtgcaccacggcatcgacctgctgttcgat
gggcagcgccaccgcatcgatctgagcgggctgaccggtgggcgcgcaatcactgtgtat
ggacaacatgaggtcgtgcgcgatttgatcgccgccaggcaggcttgcggtgcgccgctg
ctgttcgaggtgtcgcaggttgccctgcatgggttggacacgcagtcgccatccttgtcg
ttcgagcatggcgggcagcgccatgtgctggcgtgcgacttcattgccggctgcgacggc
tcgcacggcgtgtcgcgccacgcggtgccggccggcgcgttgcaggtcttcgagcggtct
tatccgtttgcatggctgggcatcctggccagcgctgcacccgcggcgcaggagctgatc
tatgcgagccatgcgcgtggctttgcgctgttctcgatgcgatcgcctgaaatcacgcgg
ctttacctgcaatgccggcccgacgaagacctggccggctggaccgatcggcgcatctgg
gacgaactgcatgcacggctcgaaaccggcgacggctggcatctgaacgaggggccggtg
ctgcagaagggcatcacgccgatgcgcagtctggtcaccgagccgatgcaatatggccgc
ctgttcctggccggcgatgccgcgcatatcgtgccgccaacgggcgcgaagggcatgaat
ctcgcggtggccgacgtgcgtaacctggcccacgcgctggtcacgcactaccgccacggc
cgcgacgatctgctggccggatactcgtcggcctgccttgcgcgcgtctggcgtgcggaa
catttctcgtggtggatgacgtcattgctgcatcgcttcgatgaccatacgccgttcacg
gcgcggctgcagcatgccgaactggcctatgtgtgcgcgtcacaggcagcatcgcgcatg
ctggccgaaaactatgtgggcctgccgttcgcgccgttgcctgcgtga

KEGG   Cupriavidus pinatubonensis JMP134: Reut_B5020
Entry
Reut_B5020        CDS       T00268                                 
Name
(GenBank) Aromatic-ring hydroxylase
  KO
K00481  p-hydroxybenzoate 3-monooxygenase [EC:1.14.13.2]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00362  Benzoate degradation
reu01100  Metabolic pathways
reu01120  Microbial metabolism in diverse environments
reu01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Reut_B5020
Enzymes [BR:reu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.2  4-hydroxybenzoate 3-monooxygenase
     Reut_B5020
SSDB
Motif
Pfam: FAD_binding_3 NAD_binding_8 Pyr_redox_3 Pyr_redox_2 Lycopene_cycl DAO Shikimate_DH Thi4 HI0933_like
Other DBs
NCBI-ProteinID: AAZ64368
UniProt: Q46R66
LinkDB
Position
2:complement(1752007..1753176)
AA seq 389 aa
MRTQVAIIGAGPAGLLLGQLLSRAGIDNIIVEQRSPEYVLGRIRAGILESVTVDALERAG
VAARLHDEGLPHAGIELSFNGQRHRIDLQALTGRTVTVYGQTEVTRDLMAARQAEGTTTI
YEAADVSLHGFDGTRPLVRYRKDGATHEIECDYIAGCDGFHGVSRQSVPATSSQLFERVY
PFGWLGILSDTPPVADELIYASHERGFALCSMRSKARSRYYVQVPSTERVEDWSDERFWD
ELRSRLDPQAAESLVTGPSIEKSIAPLRSFVCEPMRFGRLFLAGDAAHIVPPTGAKGLNL
AASDVLYLADALTARYQQDDLRELDSYSEKCLRRIWKAERFSWWMTSLLHRFPDADAFSA
RIQQAELDFLVSSEAACKALAENYVGLPY
NT seq 1170 nt   +upstreamnt  +downstreamnt
atgcgcacccaggtagccatcatcggcgccggccccgccggtcttctgctcggacaattg
ctcagccgcgcgggcatcgacaacatcatcgtggaacaacgcagccccgaatacgtactg
ggccgcatccgcgccggcatcctcgaaagcgtcaccgtggacgcgctggaacgtgcgggc
gttgccgcacggctgcatgacgaaggcctgccgcatgcgggcatcgaactgtcgttcaac
ggccagcgccatcgcatcgacctgcaagcgctgacgggccgaacggtgacggtgtatggc
cagaccgaagtcacgcgcgacctgatggccgcgcgccaggcggagggcaccacgaccatc
tacgaagccgccgacgtgagtctgcacggcttcgacggcacgcggcccttggtgcgctac
cgtaaggacggcgccacgcatgaaatcgaatgcgactatatcgcgggctgcgatggcttc
cacggtgtcagccgccagagtgtgcccgcgacgtcgtcgcagctgttcgaacgcgtctat
ccgttcggctggctgggcatcctgtcggacacgccgcctgtcgccgacgagctgatctac
gccagccacgaacgcggcttcgcactgtgcagcatgcggtccaaggcgcgcagccgctac
tacgtgcaggtgccgtcgaccgagcgcgtggaggactggtcggatgaacgcttctgggat
gaactgcgcagccggctggatccgcaagccgccgagtcgctcgtgaccggaccctctatc
gaaaagagcatcgccccgctgcgcagcttcgtgtgcgagccgatgcgtttcggccgcctg
ttcctggccggcgatgccgcacatatcgtcccgccgaccggcgccaagggcctgaacctc
gcggccagcgatgtgctgtacctcgccgacgcgctcacggcgcgctatcagcaggacgat
ttgcgggaactcgacagctattcggagaaatgcctgcgccgcatctggaaggccgagcgc
ttctcatggtggatgacctcgctgctgcaccggttccccgatgccgacgcgttctcggcc
cgcatccagcaagccgagcttgatttcctggtcagctccgaagccgcctgcaaggcgctg
gccgagaattacgtcgggctgccgtactga

DBGET integrated database retrieval system