KEGG   Cupriavidus pinatubonensis JMP134: Reut_B4403
Entry
Reut_B4403        CDS       T00268                                 
Name
(GenBank) benzoate 1,2-dioxygenase, alpha subunit
  KO
K05549  benzoate/toluate 1,2-dioxygenase subunit alpha [EC:1.14.12.10 1.14.12.-]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00362  Benzoate degradation
reu00364  Fluorobenzoate degradation
reu00622  Xylene degradation
reu01100  Metabolic pathways
reu01120  Microbial metabolism in diverse environments
reu01220  Degradation of aromatic compounds
Module
reu_M00551  Benzoate degradation, benzoate => catechol / methylbenzoate => methylcatechol
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Reut_B4403
   00364 Fluorobenzoate degradation
    Reut_B4403
   00622 Xylene degradation
    Reut_B4403
Enzymes [BR:reu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.12  With NADH or NADPH as one donor, and incorporation of two atoms of oxygen into the other donor
    1.14.12.10  benzoate 1,2-dioxygenase
     Reut_B4403
    1.14.12.-
     Reut_B4403
SSDB
Motif
Pfam: Rieske Ring_hydroxyl_A DUF4373
Other DBs
NCBI-ProteinID: AAZ63755
UniProt: Q46SX9
LinkDB
Position
2:1060637..1062034
AA seq 465 aa
MIPIHVDRGTAPARPRLSLDQFLVENHETGDYRLHRSAFTDEALFELEMKHIFEGNWIYL
AHESQIPNNNDYYTTHMGRQPVFIARNRQGELNAFINACTHRGAMLCRHKRGNKATYTCP
FHGWTFNNSGKLLKVKDPEGAGYPECFNKEGSHDLKKVARFENYRGFLFGSLNDDVLPLK
DFLGDAARIIDMIADQSPDGLEVLRGSSTYTYEGNWKLQAENGADGYHVSAVHWNYAATT
NHRKQQNEREDKIRAMDAGKWGQQGGGFYAFDHGHMLLWTRWANPEDRPNFARRAEFAER
CGEETADWMIQNSRNLCLYPNVYLMDQFGSQIRLLRPLSVDKTEVTIYCIAPKGEPDDAR
ARRIRQYEDFFNVSGMATPDDLEEFRACQQGYNGSALAWNDMCRGSKHWIEGPDEAAQRI
GLNPVMSGVRTEDEGLYTVQHRYWLDVMKKAMAEQDTEDCNGSAA
NT seq 1398 nt   +upstreamnt  +downstreamnt
atgatccccatccacgtggaccggggcacggcccccgctcgcccgcgcctctcgctcgac
cagttcctcgtcgaaaaccatgagaccggcgactaccgcctgcatcgcagcgcgttcacc
gacgaagcactgttcgaactcgagatgaagcacatcttcgagggcaactggatctacctg
gcccacgaaagccagatcccgaacaacaacgactactacaccacgcacatgggccgccag
cccgtgttcatcgcccgcaaccgccagggcgaactgaatgccttcatcaacgcatgcacc
caccgcggcgccatgctgtgccggcacaagcgcggcaacaaggccacctacacctgcccg
ttccacggctggaccttcaacaacagcggcaagctgctcaaggtgaaggaccccgaaggc
gccggctaccccgagtgcttcaacaaggaaggctcgcacgacctgaagaaggtggcgcgc
ttcgagaactaccgcggcttcctgttcggcagcctcaatgacgacgtgctgccgctcaag
gatttcctcggcgatgcggcacgcatcatcgacatgattgccgaccagtcgcccgatggc
ctggaagtgctgcgcggctcgtccacctacacctacgaaggcaactggaagctgcaggcc
gaaaacggcgccgacggctaccacgtatccgccgtgcactggaactacgcggccaccacc
aaccaccgcaagcagcagaacgagcgcgaagacaagatccgcgcgatggatgccggcaag
tggggccagcaaggcggcggcttctacgcgttcgatcatggccatatgctgctgtggacg
cgctgggccaacccggaagaccggcccaacttcgcgcgccgcgctgaattcgccgagcgc
tgcggagaggaaaccgcggactggatgatccagaactcgcgcaacctgtgcctgtacccg
aacgtgtacctgatggaccagttcggctcgcagatccgcctgctgcgcccgctgtcggtc
gacaagaccgaagtcacgatctactgcatcgcgccgaagggagaacccgacgacgcccgt
gcgcgccgcatccgccagtacgaagatttcttcaacgtgagcggcatggccacgccggac
gatctcgaggaattccgcgcctgtcagcagggctacaacggcagcgcgctggcctggaac
gacatgtgccgcggctccaagcactggatcgaaggccccgatgaagcggcgcaacgcatc
ggcctgaaccccgtcatgagcggcgtgcggaccgaggatgaagggctctacaccgtgcaa
caccgctactggctcgacgtcatgaagaaggccatggccgagcaagacacggaagactgc
aacgggagcgccgcatga

KEGG   Cupriavidus pinatubonensis JMP134: Reut_B4404
Entry
Reut_B4404        CDS       T00268                                 
Name
(GenBank) benzoate 1,2-dioxygenase, beta subunit
  KO
K05550  benzoate/toluate 1,2-dioxygenase subunit beta [EC:1.14.12.10 1.14.12.-]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00362  Benzoate degradation
reu00364  Fluorobenzoate degradation
reu00622  Xylene degradation
reu01100  Metabolic pathways
reu01120  Microbial metabolism in diverse environments
reu01220  Degradation of aromatic compounds
Module
reu_M00551  Benzoate degradation, benzoate => catechol / methylbenzoate => methylcatechol
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Reut_B4404
   00364 Fluorobenzoate degradation
    Reut_B4404
   00622 Xylene degradation
    Reut_B4404
Enzymes [BR:reu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.12  With NADH or NADPH as one donor, and incorporation of two atoms of oxygen into the other donor
    1.14.12.10  benzoate 1,2-dioxygenase
     Reut_B4404
    1.14.12.-
     Reut_B4404
SSDB
Motif
Pfam: Ring_hydroxyl_B SnoaL_4
Other DBs
NCBI-ProteinID: AAZ63756
UniProt: Q46SX8
LinkDB
Position
2:1062031..1062522
AA seq 163 aa
MSTVDIAAVQAFLYREARLLDDEQWDEWLTCYHAEARFWMPCWDDDGQLITDPEREISLI
FYPSRQGLEDRIFRIKTERSSATIPDTRTCHNLSNVEIVERDGDKLTVRFNWHTLAHRYQ
TNYSYFGMSRYVIDFAGAHPQILDKYVVLKNDYINQVIDIYHI
NT seq 492 nt   +upstreamnt  +downstreamnt
atgagcaccgtcgacatcgccgccgtccaggcgttcctgtaccgcgaagcccgcctgctt
gacgacgagcagtgggacgagtggctgacctgctaccacgccgaggcgcgcttctggatg
ccgtgctgggacgacgacggccagctcatcaccgatccggagcgcgagatctcgctgatc
ttctacccgagccgccagggcctggaagaccgcatctttcgcatcaagaccgagcgttcg
agcgcgacgattccggacacgcgcacgtgccacaacctcagcaacgtggagatcgtggaa
cgcgacggcgacaagctgaccgtacgcttcaactggcacacgctcgcgcaccggtaccag
accaactacagctacttcggcatgtcgcgctacgtgatcgactttgccggcgcgcacccg
cagatcctggacaagtatgtcgtgctcaagaacgactacatcaaccaggttatcgacatc
tatcacatctga

KEGG   Cupriavidus pinatubonensis JMP134: Reut_B4405
Entry
Reut_B4405        CDS       T00268                                 
Name
(GenBank) Ferredoxin:Oxidoreductase FAD/NAD(P)-binding:Oxidoreductase FAD-binding region
  KO
K05784  benzoate/toluate 1,2-dioxygenase reductase component [EC:1.18.1.-]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00362  Benzoate degradation
reu00364  Fluorobenzoate degradation
reu00622  Xylene degradation
reu01100  Metabolic pathways
reu01120  Microbial metabolism in diverse environments
reu01220  Degradation of aromatic compounds
Module
reu_M00551  Benzoate degradation, benzoate => catechol / methylbenzoate => methylcatechol
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Reut_B4405
   00364 Fluorobenzoate degradation
    Reut_B4405
   00622 Xylene degradation
    Reut_B4405
Enzymes [BR:reu01000]
 1. Oxidoreductases
  1.18  Acting on iron-sulfur proteins as donors
   1.18.1  With NAD+ or NADP+ as acceptor
    1.18.1.-
     Reut_B4405
SSDB
Motif
Pfam: NAD_binding_1 FAD_binding_6 Fer2 NAD_binding_6 Borrelia_P83
Other DBs
NCBI-ProteinID: AAZ63757
UniProt: Q46SX7
LinkDB
Position
2:1062586..1063605
AA seq 339 aa
MEHTIALQFEDGVTRFITCGENETLSDAAYRQKINIPLDCRDGACGTCRGLCESGSYDLP
ESSYIEDALTSEEAAQGYVLACQTRPRSDCVIRIAASSTACKTGVTKFEGAIASVDKLSD
STIGFSIDLDDAGALDFLPGQYVNVEIPGSGLTRSYSFSSAPGAGHTGFVVRNVPDGRMS
SYLTNDAQPGQRIAFSGPYGSFYLRPVQRPVLLLAGGTGIAPFLSMLDVLASNGNPHPVR
MVYGVTNDIDLVELPRIDGAAQQLTGFEYRTCVASAESGHDRKGYVTQHVEPEWLNGGDV
DIYLCGPVAMVDAVRNWLKESGVEPAGFYYEKFSASSVA
NT seq 1020 nt   +upstreamnt  +downstreamnt
atggaacacacgatcgcactgcaattcgaggacggcgttacccgcttcatcacctgcggg
gagaacgaaaccctctcggacgcggcatatcgccagaagatcaacatcccgctggattgc
cgcgacggcgcgtgcggcacgtgccgcggcctgtgcgaatcgggcagctatgacctgccg
gaatccagctacatcgaagacgcgctgacctcggaagaagccgcgcaaggctatgtgctg
gcgtgccagacacgtccgcgttcggactgcgtgatccgcatcgcggcatcgtcgacggcg
tgcaagaccggcgtcacgaagttcgaaggcgccattgccagcgtcgacaagctgtcggat
tccaccatcggcttctcgatcgacctggacgatgccggcgcgctggacttcctgccgggg
cagtacgtcaacgtggagattccgggcagcgggctgacgcgctcgtactcgttcagctcc
gcgcccggcgccggccacaccggcttcgtcgtgcgcaacgtgccggatggccgcatgagc
agttacctgacgaacgatgcccagcccggccagcgcattgcgttttccggtccttacggc
agcttctacctgcgtccggtgcagcgccctgtcctgctgctcgcaggcggaacgggcatc
gcaccgttcctgtcgatgctcgacgtgctggccagcaacggcaatccgcatccggtgcgc
atggtgtatggcgtcaccaacgacatcgacctcgtcgaactgccacgcatcgatggtgct
gcacagcagttgacaggctttgaataccgcacctgcgtagccagcgccgagagcggccac
gaccgcaagggctatgtcacgcagcatgtcgaacccgaatggctcaacggcggcgatgtc
gacatctacctgtgcggccccgtggcaatggtcgatgcggtgcggaactggctcaaggaa
agcggcgtcgagccggcaggcttctactacgaaaaattctcggccagcagcgtggcctga

DBGET integrated database retrieval system