KEGG   Cupriavidus pinatubonensis JMP134: Reut_B4679
Entry
Reut_B4679        CDS       T00268                                 
Name
(GenBank) Monooxygenase, FAD-binding protein
  KO
K10676  2,4-dichlorophenol 6-monooxygenase [EC:1.14.13.20]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00361  Chlorocyclohexane and chlorobenzene degradation
reu01100  Metabolic pathways
reu01120  Microbial metabolism in diverse environments
reu01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00361 Chlorocyclohexane and chlorobenzene degradation
    Reut_B4679
Enzymes [BR:reu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.20  2,4-dichlorophenol 6-monooxygenase
     Reut_B4679
SSDB
Motif
Pfam: FAD_binding_3 FAD_binding_2 Pyr_redox_2 NAD_binding_8 DAO Pyr_redox_3 Thi4 GIDA Orn_DAP_Arg_deC Fe-ADH HI0933_like ThiF Trp_halogenase
Other DBs
NCBI-ProteinID: AAZ64028
UniProt: Q46S56
LinkDB
Position
2:1374676..1376454
AA seq 592 aa
MKTIEVPVLVVGAGPAGLTATALLATYGVRTLTITKYAGTANSPRAHITNQRTMEVFRDL
GIEERVRQVATPHALMSHCIWATSFAGTEIARLHAWGGSEQRRADYALASPSQMCNAPQH
LMEPEILACARERGAEFLFNTELKQISQDANHVTAILQDRITGETIQVKALYAIGADGGA
STVVPQCGFEMQGEMGLGAAVNCWLEVDLAQYCEQRPGTLYWMTQPGNNYWVGSGTYICV
RPWNEWVLLFMYDPAEGEPDLSEEAVIRRARATIGDDSLPIKVKAVSKWQINHVAAKTMR
KGRVFIAGDAAHRHPPANGLGTNTSIQDAFNLAWKLAHVIRGNADDALLDSYSAERQPVA
RKVVDRAMKSVRNMLPIAKALGFEPGQSEAQGWENVDELFSDTERGRERRHALQEAVELQ
NYQFNCHGVELGQFYESAAVVPDERPREPFTRDPELYYHPSSAPGSVVPHAWLEHHKQRV
STLDLVGHGRFTLLTGVGGEAWRGIAARVGKQLGIEIDVVSIGGPNCDAHDVYGTWQSLR
GTTDAGTVLVRPDRFVCWRRQDCSTDAEHALSEAMRGILGRQSSSADRRQAA
NT seq 1779 nt   +upstreamnt  +downstreamnt
atgaagacgattgaagtaccagttctcgtggtcggcgccgggccggctggccttaccgcg
acggccctgcttgccacgtatggggtgcgaaccctgacgatcaccaagtacgcgggcacc
gccaactccccgcgtgcccacatcaccaaccagcgcaccatggaagtgttccgggacctg
gggatcgaagagcgcgtgcggcaagtggcgacgccccatgcgctgatgagccactgcatc
tgggccaccagctttgccggtacagagattgcccgcctgcacgcctggggcggctcggaa
cagcgacgggccgactatgcactggccagcccgtcgcagatgtgcaatgcgccgcagcac
ctgatggagcccgagatccttgcctgcgcacgcgaacgcggggccgagttcctcttcaac
acggagttgaagcagatttcgcaggacgcgaatcacgtcaccgccatcctgcaggaccgc
atcaccggagagaccattcaggtgaaagcactctatgctattggcgccgatggcggcgcc
agcaccgtggtgccccagtgcggcttcgagatgcaaggggaaatggggctgggcgcagcg
gtcaactgctggctggaagtcgacctggcccagtactgcgaacaacgtcccggcaccctg
tactggatgacgcagcccggcaataactactgggtcggcagcggcacatacatctgcgtg
cgcccgtggaatgaatgggtgctgctgttcatgtacgaccccgccgaaggcgaacccgac
ctgagcgaagaggccgtgatccgccgcgcgcgggccaccatcggcgacgactcgctgcca
atcaaggtcaaggcggtcagcaagtggcagatcaaccatgtcgcggcgaagaccatgcgc
aaggggcgcgtgttcattgccggcgatgccgcccaccggcacccgcccgccaatgggctc
ggcaccaatacgtcgatccaggacgccttcaacttggcctggaaactcgcgcacgtcatc
cgcggcaatgcggacgacgccctgctggacagctactccgccgaacgccagccggtagca
cgcaaggtggtggaccgcgccatgaagtcggtgcgcaacatgctgccgatcgcgaaggcg
ctggggttcgagccaggccagagcgaagcacagggatgggagaatgtcgatgaactgttc
agcgataccgaacgcggccgcgagcgccggcacgccctgcaggaagccgtcgaactgcag
aactaccagttcaactgccatggcgtggaactcggccagttctacgagtctgcggcagtg
gtgccggacgaacgcccacgcgaacccttcacgcgcgatcccgaactgtactatcacccg
agctctgcgccgggcagcgtggtgccgcatgcatggctggagcatcacaagcagcgcgtc
tccacgctggatctggtcggccacggccgcttcacgctgctgaccggggtgggcggagag
gcctggcgcggcatcgcggcgcgcgtcggcaagcagttgggcatcgagatcgacgtggtg
agcatcggcggcccgaactgcgatgcccacgacgtctacggcacctggcaaagcctgcgc
ggcaccacggacgccggtaccgtcctggtacgccctgaccgtttcgtctgctggcgccgt
caggattgcagcaccgatgccgagcacgcgctgtcggaagcgatgcggggcatcctgggc
cggcagtccagcagcgccgaccgccgtcaggcggcataa

KEGG   Cupriavidus pinatubonensis JMP134: Reut_D6462
Entry
Reut_D6462        CDS       T00268                                 
Name
(GenBank) Monooxygenase, FAD-binding
  KO
K10676  2,4-dichlorophenol 6-monooxygenase [EC:1.14.13.20]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00361  Chlorocyclohexane and chlorobenzene degradation
reu01100  Metabolic pathways
reu01120  Microbial metabolism in diverse environments
reu01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00361 Chlorocyclohexane and chlorobenzene degradation
    Reut_D6462
Enzymes [BR:reu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.20  2,4-dichlorophenol 6-monooxygenase
     Reut_D6462
SSDB
Motif
Pfam: FAD_binding_3 Pyr_redox_2 FAD_oxidored GIDA NAD_binding_8 Thi4 FAD_binding_2 IRF-3
Other DBs
NCBI-ProteinID: AAZ65760
UniProt: P27138
LinkDB
Position
p1:complement(17688..19484)
AA seq 598 aa
MALTIETDVLVVGTGPAGASAGALLARYGVRTMLINKYNWTAPTPRAHITNQRTMEILRD
LGLEAEARLYAAPNDLMGENTICASLAGEEFGRIRTWGTDVRRRADYDECSPTSMCDLPQ
NYLEPILVKSAALDGCKVRFDTEYLGHEQDADGVSSRLRDRLNGEEFTVRSKYLIGADGA
NSRVVSDLDLPLEGTMGKSGSINLLFEADLDRYVAHRPSVLYWVIQPGSDIGGLGIGVVR
MVRPWNKWLAIWGYDVEQGPPEISESFARRIVHNLIGDDSVPLKIEGISTWTVNDMYATR
LQQGRVFCAGDAVHRHPPTNGLGSNTSIQDSFNLAWKIAMVLNGTADESLLDTYTIERAP
IAKQVVCRANKSLEDFPPIAMALGLPQAKSADEMKSNMARRKEPGPEAQAQRTRLREAIA
GTNYVYNAHGVEMNQRYDSPAIVADNSPDEVFRDVELYHQASTRPGAPMPHVWVYASGDG
HRISTKDLCGKGNFTLFTGIGGAAWQDAAAAVSRQLGVAVTVRIIGPGQAYEDHYGDFAR
ISEIIDTGAILVRPDFHVAYRATSLPADAAGDLVSAMRRILGRQSERSSALRVTSRAI
NT seq 1797 nt   +upstreamnt  +downstreamnt
atggcattgacgatcgaaaccgacgtgctggtcgttggcaccgggccggcgggcgcttcg
gcgggggcactgcttgcgcgatacggtgtcaggacgatgctcattaacaagtacaactgg
acggctccgacgccgcgtgcccacatcaccaaccaacgcacaatggagatcctgcgtgat
ctcggtctcgaagctgaagcccgcctctacgccgcgccgaatgacctaatgggcgagaac
accatctgcgcctcgttggccggcgaggagttcggtcggattcgcacctgggggacggat
gttcgccggcgcgccgattacgacgaatgttcgccgacctccatgtgcgacctgccacag
aactatctcgagccgattctcgtcaagtcggccgcactcgacggctgcaaggtgcgcttc
gacacagagtatcttggacacgaacaggatgctgacggcgtgtcgtcgcgcttgcgcgat
cgtctgaatggcgaagagtttaccgtccggtcgaaatatctgatcggcgccgacggcgcc
aacagccgcgtcgtgtcagacctggacctgccgctcgaaggtaccatgggcaagtccggt
tccatcaacttgctgttcgaggctgatctcgaccgctacgtcgcgcatcgtccatcggtc
ctttactgggtcatccagcccggctccgatatcggcggtctcggcatcggcgtggtgcgc
atggtccggccgtggaacaaatggctggcgatctgggggtacgacgtcgagcagggcccg
ccggagatctcggaatccttcgcccgccgcatcgtccacaatctgatcggcgatgacagc
gtgccgctgaaaattgagggcatctcgacctggacggtcaacgacatgtacgcgacccgg
ttgcagcaaggacgggtcttctgcgccggcgacgcggtccaccggcatccgccgaccaac
ggactcggctcaaacacctccatccaggacagcttcaatctcgcctggaagatcgccatg
gtgctgaacggcacggccgacgagagcctgctggacacctacacgatcgagcgggcgccg
atcgcgaagcaggtggtctgcagggcgaacaagtcgcttgaggatttcccgccgatcgcg
atggctctggggttgccgcaggccaagagcgccgacgagatgaagagcaacatggctcgc
cgcaaggaacctgggcccgaggcgcaagcgcagcgcacgcggttacgcgaggccatcgcc
gggaccaattacgtttacaacgcccacggcgtcgaaatgaatcagcgttacgacagtccc
gcgatcgtggcagacaattcgccggacgaagtcttccgcgacgtcgagctctatcaccag
gcgtcgacgcggcctggagcgcccatgccgcatgtctgggtctatgcgagtggtgatgga
caccgtatctcaacaaaggatctctgcgggaagggcaacttcactctctttaccgggatt
ggcggcgcagcctggcaggatgccgcggcggccgtgagccggcaactcggggtggcagtg
acggtgcgcatcattgggcctggccaggcctacgaggatcattacggcgacttcgcgaga
atttccgagatcatcgacaccggcgccatcctggtgcggccggatttccacgtcgcctat
cgggcgacgtccttgccggccgatgcggcaggcgacctcgtgtccgccatgaggcggatc
ctcggacgccagtcagagaggtcgagcgcgctgcgcgttacgtctcgagctatataa

KEGG   Cupriavidus pinatubonensis JMP134: Reut_D6470
Entry
Reut_D6470        CDS       T00268                                 
Name
(GenBank) Monooxygenase, FAD-binding
  KO
K10676  2,4-dichlorophenol 6-monooxygenase [EC:1.14.13.20]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00361  Chlorocyclohexane and chlorobenzene degradation
reu01100  Metabolic pathways
reu01120  Microbial metabolism in diverse environments
reu01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00361 Chlorocyclohexane and chlorobenzene degradation
    Reut_D6470
Enzymes [BR:reu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.20  2,4-dichlorophenol 6-monooxygenase
     Reut_D6470
SSDB
Motif
Pfam: FAD_binding_3 Pyr_redox_2 FAD_binding_2 DAO FAD_oxidored Thi4
Other DBs
NCBI-ProteinID: AAZ65768
UniProt: Q46M62
LinkDB
Position
p1:complement(26765..28525)
AA seq 586 aa
MNEKANTVETDVLVVGTGPAGAASTLLLATYGVKTLCVSKYATTSRTPRSHITNQRTMEV
MRDLGIEAECEAMASPAELMGENVYCTSLVGDELGRVLTWGTHPQRRADYDLASPTHMCD
LPQNLLEPILVNNAARRGADVRFHTEFISLNQDDAGVTATVHDHLLDRQYDIRAKYLIGA
DGANSRIVDQVGLPVEGKMGVSGSINVVFEADLTKYVGHRPSVLYWVIQPGSNVGGLGIG
VIRMVRPWNKWLCIWGYDIADGTPAVDEAHARQIVHSLLGDATIPVKIESTSTWTVNDMY
ATRLFDKRVFCMGDAVHRHPPTNGLGSNTSIQDAFNLCWKLSHVLRGKAGPELLATYDEE
RAPVARQVVQRANKSLGDFPPILAALGLFDTKDPEQMQRNISRLKEQSVEAQEQRAALRA
AIDNTQYVYNAHGVEMNQRYRSAAIVPDETPDPGFRRDAELYHDHSSRPGAPLPHVWLTR
HGRRVSTLDLCGKGRFTLLSGITGSPWLEAASHAAESLGIGLDVHIIGPGQELEDLYGDF
ARVREIEESGALLVRPDNIICWRAMQWEKSASDPLRAALARALCAH
NT seq 1761 nt   +upstreamnt  +downstreamnt
atgaacgaaaaagccaacaccgtcgaaaccgacgttctcgtcgtcggcaccggtcccgcc
ggggcggcgtcgaccctgcttctcgcgacctacggggtgaagacgctgtgcgtcagcaaa
tacgcgaccacgtcgcgcaccccgcgctcgcacatcaccaaccagcgaacgatggaggtg
atgcgcgacctcggcatcgaggcggagtgcgaggccatggcctcgccggccgagctgatg
ggcgagaacgtctattgcacgagcctcgtcggcgacgaactgggccgcgtgctgacctgg
ggcacgcatccgcagcgccgggccgactacgacctcgcttcgcccacgcacatgtgcgac
ctgccgcagaacctgctcgaaccgatcctcgtcaacaacgcggcgcggcgcggtgccgac
gtgcgctttcacaccgagttcatctcgttgaaccaggacgatgcgggcgtcacggcgacc
gtgcacgaccacctgctggatcgccagtacgacatccgggccaaatacctcatcggcgcg
gatggcgcgaattcccggatcgtggaccaggtcggcctgccggtggaagggaagatgggc
gtctccggctccatcaacgtcgtgttcgaggcggacctcacgaagtacgtgggccatcgg
ccgagcgtgctgtattgggtcatccagcccggctccaatgtcggcggcctcggcatcggc
gtcattcgcatggtgcggccgtggaacaagtggctttgcatctggggctacgacatcgcc
gatggcaccccggccgtcgacgaagcgcatgcgcgccagatcgtccattcgctgttgggc
gacgcgacgatcccggtcaagatcgaatcgacctcgacctggacggtgaacgacatgtac
gccacgcggctgttcgacaagcgggtgttctgcatgggcgacgcggtccatcggcacccg
ccgaccaacggcctgggctcgaacacgtcgatccaggacgccttcaacctctgctggaaa
ctctcgcacgtgcttcgaggaaaggccggcccggaactgctcgccacctacgacgaggag
cgtgcgccggtcgccaggcaggtggtgcaacgcgcgaacaagagcctcggggacttcccg
ccgatcctcgccgcgctgggcctgttcgacacgaaggaccccgaacagatgcagcgcaac
atctcccgcctgaaggaacagagcgtggaggcgcaggaacagcgcgccgcattgcgcgct
gccatcgacaacacgcagtacgtctacaacgcccacggcgtcgagatgaaccagcgctat
cggtcggcggcgatcgttccggacgagacaccggacccgggattccgccgcgacgcggag
ctctaccacgaccacagcagccgacccggcgcgcccctgccgcacgtctggctcacgcgc
cacggccgccgcgtatcgacgctcgatctttgcggcaagggccggttcaccctgctctcg
ggcatcaccggatcgccctggctcgaggccgcgagccatgccgcggagtcgctcggcatc
ggcctggacgtgcacatcatcggccccggccaggaactcgaggacctgtacggcgatttc
gcccgtgttcgcgagatcgaggagagcggcgcattgctcgtgcgccccgacaacatcatc
tgctggcgagcgatgcagtgggaaaagagcgcgagcgacccgcttcgcgcggcgctcgca
cgggcgctctgcgcgcactga

DBGET integrated database retrieval system