KEGG   Cupriavidus pinatubonensis JMP134: Reut_B5674
Entry
Reut_B5674        CDS       T00268                                 
Name
(GenBank) Ferredoxin:Oxidoreductase FAD/NAD(P)-binding:Oxidoreductase FAD-binding region
  KO
K15765  toluene monooxygenase electron transfer component [EC:1.18.1.3]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00623  Toluene degradation
reu00920  Sulfur metabolism
reu01100  Metabolic pathways
reu01120  Microbial metabolism in diverse environments
reu01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    Reut_B5674
  09111 Xenobiotics biodegradation and metabolism
   00623 Toluene degradation
    Reut_B5674
Enzymes [BR:reu01000]
 1. Oxidoreductases
  1.18  Acting on iron-sulfur proteins as donors
   1.18.1  With NAD+ or NADP+ as acceptor
    1.18.1.3  ferredoxin---NAD+ reductase
     Reut_B5674
SSDB
Motif
Pfam: NAD_binding_1 FAD_binding_6 Fer2 NAD_binding_6
Other DBs
NCBI-ProteinID: AAZ65019
UniProt: Q46PB5
LinkDB
Position
2:complement(2507800..2508798)
AA seq 332 aa
MKYQISIEGGAVFTVAAEEDTLLRGALRAGMALPHECSVGGCGACRFDLVDGLMESVWPE
APGLSERDRKRGKYLACQSRPLSDCTIRVRCDESYRPAVRAHRRAAELLARRALTPDMSE
FTFRVPGATEFRPGQYALLYPPRAPGARAYSMANLPNEEGIWKFVIRRVPGGAGSNALFD
QVGIGDSVVLDGPYGHAYLREDSARDIVCIAGGSGLAPMLSVARGALAGSGSRRVHFFYG
ARGQADLGALDALEKLAEDKRVTLSVALSAPESTWKGPTGFVHEEVERNLTASLGSYDFY
FAGPPLMIEAMQALLMHKHQVPFGQIRFDRFV
NT seq 999 nt   +upstreamnt  +downstreamnt
atgaaataccagatatcgatcgaaggcggcgcggtgttcaccgtcgccgcggaggaagac
acgctgctgcgcggcgccctgcgcgccggcatggccctgccgcacgagtgcagcgtgggc
ggctgcggcgcgtgccgcttcgaccttgtggacgggctcatggaatccgtctggcctgag
gcgcccggcctgtccgagcgtgaccgcaagcgtggcaagtaccttgcgtgccagtcgcgg
ccgctaagcgactgcacgatacgtgtgcgctgcgacgaatcgtatcgcccggcggtccgg
gcgcatcgccgcgcagcggaactcctggcacgccgcgcgctgacccctgacatgagcgaa
ttcacgttccgggttccaggcgcgaccgagttccggcccggccagtacgcgctgctctac
ccgccccgtgcaccgggcgcccgcgcctattcgatggccaacctgcccaacgaggaaggc
atctggaagttcgtgatccgccgcgtgccgggcggggctggcagcaacgcgctgttcgac
caggtcggaatcggggacagcgtcgtgctcgacgggccgtacggccacgcctaccttcgt
gaggacagtgcccgcgacattgtctgcatcgccggtggctcgggcctggcgccaatgctg
tcggtcgcacgcggagcactcgccggtagcggttcgcggcgcgtccacttcttttatggc
gcccgggggcaggctgacctcggtgccctcgacgccctggaaaaacttgccgaagacaag
cgggttacgctgtcggtggcactgtccgcaccggagagcacctggaaggggccaacgggg
ttcgtgcacgaggaagtcgagcgtaacctgacagcttccctcggcagctacgacttctat
tttgccgggccgccactcatgatcgaagccatgcaggcgctcctgatgcacaagcaccag
gtaccgttcgggcagatccgcttcgaccgctttgtctag

KEGG   Cupriavidus pinatubonensis JMP134: Reut_B5675
Entry
Reut_B5675        CDS       T00268                                 
Name
(GenBank) toluene 4-monooxygenase protein E
  KO
K15764  toluene monooxygenase system protein E [EC:1.14.13.236 1.14.13.-]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00623  Toluene degradation
reu01100  Metabolic pathways
reu01120  Microbial metabolism in diverse environments
reu01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00623 Toluene degradation
    Reut_B5675
Enzymes [BR:reu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.236  toluene 4-monooxygenase
     Reut_B5675
    1.14.13.-
     Reut_B5675
SSDB
Motif
Pfam: Phenol_Hydrox
Other DBs
NCBI-ProteinID: AAZ65020
UniProt: Q46PB4
LinkDB
Position
2:complement(2508847..2509845)
AA seq 332 aa
MTTQPDVLKPLKTWSHLAARRRKPSEYEIVSTNLHYTTDNPDAPFELDPNFEMAQWFKRH
RNASPLKHADWNAFRDPDELVYRTYNMLQDGQETYVSGLLDQFSERGHDSMLEHSWAGTL
ARLYTPARYLFHALQMGSAYLTQMAPASTISNCAAYQTADSLRWLTHTAYRTRELSQTFG
DVGFGTDERRYWEQDPAWQGWRKLVEHALVAWDWAECFVAFSLVLRPAMEEAVLRGLGEA
ARHNGDTLLGLLTDAQLADVQRHRHWAGALVRMALETPGNRDVLAGSIARWAPLADDAIS
AYCAALPDAPNAKARACAAVRDFWDSIGLAGL
NT seq 999 nt   +upstreamnt  +downstreamnt
atgaccacgcaacccgacgtcctcaagccgctgaagacctggagccacctggccgcgcgc
cggcgcaagccgagcgagtacgagatcgtctcgacgaacctgcactacacgaccgacaac
cccgacgcgccgttcgagctcgatccgaacttcgagatggcgcagtggttcaagcgtcac
cgcaacgcctcgccgctgaaacacgccgactggaacgccttccgcgatcccgacgaactc
gtctaccgcacctacaacatgctgcaggacggccaggaaacctatgtgtccggcctgctg
gaccagttttctgaacgcggccacgactccatgctggagcactcctgggccggcacgctg
gcgcggctgtacaccccggcacgctatctgttccacgcactgcaaatgggatccgcctac
ctgacgcagatggcccccgcatccacgatctcgaactgcgccgcctaccagaccgccgac
tcgctgcggtggctgacccacaccgcatatcgcacgcgagagctgtctcagaccttcggc
gacgtgggctttggcaccgacgagcgcaggtactgggagcaggacccggcctggcagggc
tggcgcaagctggtcgaacacgcgctcgtggcatgggactgggcagagtgcttcgtcgcc
ttcagcctggtattgcggccggcgatggaggaagccgtcctgcgcgggcttggcgaggcg
gcgcgccacaacggcgacaccctgctcggcctgctgactgacgcgcagcttgccgacgtc
cagcggcaccggcactgggccggcgcgctcgtccgcatggccctggagacgccgggcaat
cgtgacgtgctggccggctcgattgcccggtgggcgccgctcgcggacgatgcaatcagt
gcctactgcgcggcgttgcccgacgcgccgaacgcgaaggcgcgggcctgcgcggccgtg
cgcgacttctgggacagcatcggcctggcaggtctgtaa

KEGG   Cupriavidus pinatubonensis JMP134: Reut_B5676
Entry
Reut_B5676        CDS       T00268                                 
Name
(GenBank) toluene 4-monooxygenase protein D
  KO
K15763  toluene monooxygenase system protein D [EC:1.14.13.236 1.14.13.-]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00623  Toluene degradation
reu01100  Metabolic pathways
reu01120  Microbial metabolism in diverse environments
reu01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00623 Toluene degradation
    Reut_B5676
Enzymes [BR:reu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.236  toluene 4-monooxygenase
     Reut_B5676
    1.14.13.-
     Reut_B5676
SSDB
Motif
Pfam: MmoB_DmpM
Other DBs
NCBI-ProteinID: AAZ65021
UniProt: Q46PB3
LinkDB
Position
2:complement(2509858..2510175)
AA seq 105 aa
MSKDHNTAEAYRNNRVGPVLRASSITSGVIEAAQEDNPGKEIRVDDKLAYVRIDTDGELI
LRRATLEDALGRPFRMSELEVNLSSFAGRIETTDDYVRFYYEKTL
NT seq 318 nt   +upstreamnt  +downstreamnt
atgagcaaagaccacaacaccgccgaggcctaccgaaacaaccgcgtcggccccgtactg
cgcgcgagcagcatcacgtccggcgtcatcgaggccgcgcaggaagacaacccagggaag
gaaatccgcgtcgacgacaagctcgcatacgtgcgcatcgacaccgacggcgaactgatc
ctgcgccgggccacgctggaggatgcgctgggccgcccgttcaggatgtccgagctggag
gtcaacctcagctcgttcgcgggccgcatcgagactacggacgactacgtccgcttctat
tacgaaaagacgctgtaa

KEGG   Cupriavidus pinatubonensis JMP134: Reut_B5677
Entry
Reut_B5677        CDS       T00268                                 
Name
(GenBank) toluene 4-monooxygenase protein C
  KO
K15762  toluene monooxygenase system ferredoxin subunit
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00623  Toluene degradation
reu00920  Sulfur metabolism
reu01100  Metabolic pathways
reu01120  Microbial metabolism in diverse environments
reu01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    Reut_B5677
  09111 Xenobiotics biodegradation and metabolism
   00623 Toluene degradation
    Reut_B5677
SSDB
Motif
Pfam: Rieske Rieske_2 FtrD-like
Other DBs
NCBI-ProteinID: AAZ65022
UniProt: Q46PB2
LinkDB
Position
2:complement(2510195..2510545)
AA seq 116 aa
MHEVTMNFQKVSTLDELWEGDMAEVEVDGHVIVLVRPEGGAPRAFQGICPHQDIPLAEGK
FDGRVLMCRAHQWTFDANTGKGINPGGCRLAEYAVKVDGDDILIAVEGVEPLFANC
NT seq 351 nt   +upstreamnt  +downstreamnt
atgcatgaggtcaccatgaatttccagaaagtctccacgctcgacgagttgtgggaaggc
gacatggccgaagtggaggtggacggccacgtcatcgtgctcgtccgccccgaaggcggc
gcgccacgcgcattccagggcatctgtccgcaccaggacattccgctcgcagagggaaag
ttcgacgggcgcgtgctgatgtgccgggcccaccagtggaccttcgatgccaacacaggc
aagggcatcaaccccggtgggtgccggcttgccgagtatgccgtcaaggtggatggcgac
gacatcctcatcgctgtcgagggcgtcgaaccactgttcgccaactgctga

KEGG   Cupriavidus pinatubonensis JMP134: Reut_B5678
Entry
Reut_B5678        CDS       T00268                                 
Name
(GenBank) toluene 4-monooxygenase protein B
  KO
K15761  toluene monooxygenase system protein B [EC:1.14.13.236 1.14.13.-]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00623  Toluene degradation
reu01100  Metabolic pathways
reu01120  Microbial metabolism in diverse environments
reu01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00623 Toluene degradation
    Reut_B5678
Enzymes [BR:reu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.236  toluene 4-monooxygenase
     Reut_B5678
    1.14.13.-
     Reut_B5678
SSDB
Motif
Pfam: TmoB
Other DBs
NCBI-ProteinID: AAZ65023
UniProt: Q46PB1
LinkDB
Position
2:complement(2510538..2510798)
AA seq 86 aa
MALFPVISNFQYDFVLQLVAVDTENSMDEVAAAAAHHSVGRRVAPQPGKVVRVRRQGGDQ
FYPRDARIGDTDIKPMESLEFIFCDA
NT seq 261 nt   +upstreamnt  +downstreamnt
atggcactgtttccagtgatttcgaattttcagtacgacttcgtgctgcagctcgtcgcc
gtcgatacggagaactcgatggacgaggtagcggcggcggccgcgcaccattcagtcggc
cgtcgcgtggcgccccagcccggcaaggtcgtccgggtgcggcgtcaggggggcgaccag
ttctacccccgcgacgcccggattggcgacaccgatatcaagccgatggagtcgctcgaa
ttcatcttttgcgatgcatga

KEGG   Cupriavidus pinatubonensis JMP134: Reut_B5679
Entry
Reut_B5679        CDS       T00268                                 
Name
(GenBank) toluene 4-monooxygenase protein A
  KO
K15760  toluene monooxygenase system protein A [EC:1.14.13.236 1.14.13.-]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00623  Toluene degradation
reu01100  Metabolic pathways
reu01120  Microbial metabolism in diverse environments
reu01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00623 Toluene degradation
    Reut_B5679
Enzymes [BR:reu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.236  toluene 4-monooxygenase
     Reut_B5679
    1.14.13.-
     Reut_B5679
SSDB
Motif
Pfam: Phenol_Hydrox YHS
Other DBs
NCBI-ProteinID: AAZ65024
UniProt: Q46PB0
LinkDB
Position
2:complement(2510823..2512328)
AA seq 501 aa
MALLERAAWYDIARTTNWTPTYVAESDLFPEVMAGAQGVPMEIWETYDEPYKTSYPEYVR
IQREKDAGAYSVKAALERSRMFEDADPGWLSILKAHYGAIALGEYAAMSAEARMARFGRA
PGMRNMATFGMLDENRHGQLQLYFPHDYCPKDRQFDWAHKAYHTNQWGAIAARSTFDDLF
MSRSAIEIAVMLTFAFETGFTNMQFLGLAADAAEAGDFTFASLISSIQTDESRHAQIGGP
ALQILIANGRKEQAQQLVDVAIARAWRLFSLLTGTSMDYATPLQHRKESFKEFMTEWIVG
QFERTLIDLGLDLPWYWDQMINEFDYQHHAYQMGIWFWRPTVWWNPAAGMTPDCRDWLEE
KYPGWNDTFGKAWDVIIDNLLAGRKELTVPETLPIVCNMSQLPICAVPGNGWNVRDYPLE
YNGRTYHFNSEIDRWVFQQDPVRYRDHLTLVDRFLAGHIQPPDLGGALRYMNLAPGEIGD
DAHQYAWVEAYRRQREQNKAA
NT seq 1506 nt   +upstreamnt  +downstreamnt
atggcgcttttggaacgcgcagcgtggtacgacattgcccgcacaacgaactggacgccg
acgtacgtcgccgagtccgaccttttcccggaggtcatggcaggggcgcagggcgtgccc
atggaaatctgggaaacctatgacgagccctacaagacgtcgtatccggagtacgtccgc
attcagcgcgagaaggacgccggcgcctattccgtgaaggccgcgctcgagcgcagccgc
atgttcgaggacgccgatcccggctggctgtcgatcctgaaggcgcattacggcgccatc
gcgctcggcgaatacgcggcgatgagcgcggaggcgcgcatggcccgcttcggccgcgcg
ccagggatgcgcaacatggccaccttcggcatgctcgacgagaaccgtcacgggcaattg
cagctctactttccgcacgactactgcccgaaggaccggcaatttgactgggcgcacaag
gcctatcacaccaaccaatggggcgcgatcgccgcccgcagcaccttcgacgacctgttc
atgtcgcgaagcgcgatcgagatcgccgtgatgcttacgtttgccttcgaaacgggtttc
accaacatgcagttcctcgggctggcggccgatgcggcggaagccggcgatttcaccttc
gccagcctcatctcgagcatccagacggacgagtcgcgacacgcgcagatcggcggcccg
gcactgcagatcctgatcgccaacgggcgcaaggagcaggcgcagcagctcgtggacgtc
gccattgcacgcgcatggcgcctgttctccctgctgactggcacgtcgatggactacgcc
acgccgctgcagcatcgcaaggagtcattcaaggagttcatgacggaatggatcgtcggc
cagttcgagcgcacgctgatcgacctcggtctcgacctgccctggtactgggaccagatg
atcaatgagttcgactaccagcaccatgcctatcagatgggcatctggttctggcggccg
accgtctggtggaacccggccgccggcatgacgccggactgccgtgactggctcgaggaa
aagtatcccggctggaacgacacgttcggcaaggcctgggacgtcatcatcgacaacctg
cttgcgggcaggaaggaattgaccgtccccgagaccctgcccatcgtctgcaacatgagc
cagttgccaatctgcgcggtgcccggcaacggctggaacgtcagggactatccgctcgag
tacaacggccgcacgtaccacttcaactccgagatcgaccgctgggtcttccagcaggac
ccggtgcgctaccgcgaccacctgaccctggtcgaccgtttcctcgccgggcacatccag
ccgcccgacctggggggcgcactccggtacatgaacctcgcccccggcgagattggcgac
gacgcacaccagtacgcgtgggtagaggcctaccgccgccagcgcgaacagaacaaggcc
gcctga

DBGET integrated database retrieval system