KEGG   Cupriavidus pinatubonensis JMP134: Reut_B5770
Entry
Reut_B5770        CDS       T00268                                 
Name
(GenBank) Flavin reductase-like, FMN-binding protein
  KO
K00484  flavin reductase (NADH) [EC:1.5.1.36]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00350  Tyrosine metabolism
reu00740  Riboflavin metabolism
reu01100  Metabolic pathways
reu01120  Microbial metabolism in diverse environments
reu01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    Reut_B5770
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    Reut_B5770
Enzymes [BR:reu01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.36  flavin reductase (NADH)
     Reut_B5770
SSDB
Motif
Pfam: Flavin_Reduct
Other DBs
NCBI-ProteinID: AAZ65113
UniProt: Q46P21
LinkDB
Position
2:complement(2595772..2596323)
AA seq 183 aa
MSIDANQFRTAMRCLAGHVCLITTLSADGSRAGLTATAVCSVSADPPTLLACVNRNSASF
HAIQASGIFAVNVLAVESRRLADRFASPIPAEEKFADGVWGRASTGAPVFRDALVSFDCR
VASALDVGTHGILFGAIDTATPRADRARPLLYAHGSYGEFSSTDAAAAPELLWIPTWDPE
PAS
NT seq 552 nt   +upstreamnt  +downstreamnt
atgagcatcgacgccaaccagttcaggacagcgatgcgctgcctcgccggacatgtctgc
ctgattaccacgttgtcggcggacggctcgcgtgcggggctaacagccacggccgtctgc
tcggtctcggccgatcctcccacgctgctcgcctgtgtcaaccgcaacagtgcgtcgttc
cacgcgatccaggcatcagggatctttgcggtgaacgtgctggcggtggaaagccgccgg
ctggcggaccgctttgccagccccataccggcagaggaaaagtttgccgacggcgtatgg
ggacgcgccagcaccggcgcgccagttttccgcgacgcgttggtcagcttcgattgccga
gtggccagtgcgttggacgttggcacgcacggcattctcttcggcgccatcgacaccgca
acgccccgcgccgaccgcgcccggccgctgctgtacgcgcacggcagctacggcgaattt
tcatcgaccgacgctgccgcagctccagaactgctctggattccgacatgggacccggag
cctgctagctga

KEGG   Cupriavidus pinatubonensis JMP134: Reut_C6314
Entry
Reut_C6314        CDS       T00268                                 
Name
(GenBank) 4-hydroxyphenylacetate 3-hydroxylase
  KO
K00483  4-hydroxyphenylacetate 3-monooxygenase [EC:1.14.14.9]
Organism
reu  Cupriavidus pinatubonensis JMP134
Pathway
reu00350  Tyrosine metabolism
reu01100  Metabolic pathways
reu01120  Microbial metabolism in diverse environments
reu01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:reu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    Reut_C6314
Enzymes [BR:reu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.9  4-hydroxyphenylacetate 3-monooxygenase
     Reut_C6314
SSDB
Motif
Pfam: HpaB_N HpaB
Other DBs
NCBI-ProteinID: AAZ65617
UniProt: Q46ML0
LinkDB
Position
mega:487011..488552
AA seq 513 aa
MPRLRLGGNQTTQMKESKVQNGKLRTGEDYLQNLRDGRCVYVNGERVKDVTTHPAFSRGA
QSLANLYDIAAAPENRERMTFTSPTSGNPVLRAYQIPKTHEDLRAKRLASEMWSEATFGL
MGRSPDHVSNFFVGYAAVPSVFAAGGQEYADNVVSFYEHLRENHLYTTYAIVPPQIDRSK
PAHQQSDPTLYAGVVKERDDGIIIKGAQQLATAGVYSDYIYVSSIHPMQPGDENYAFGVA
IPANAPGVKLYPRRPFGALATNSFDYPLSSRFDESDCFVVLDNVFVPWEHVFIYRNLQVA
RDQWWKTPAHLYGNLQAQARYITKLRFMMGLAKRMNEMTGNDANPAVQIQMGELASLVSI
IEHALISQEVAATTDANGVLWPSRTGLYSIMALQSELNARMVEIIRELSGAGMITLPSSV
EDFRNPETAEDVQRYYASSSSDAKERVALMRMAWDFIGSEFGNRHQQYEKFYGGASFLVK
QNVHRHFDYDRSKKMVESALALPAFSNVPSKFL
NT seq 1542 nt   +upstreamnt  +downstreamnt
atgccgcgcctgagactgggcggcaatcagaccactcaaatgaaggagtcaaaggtgcaa
aacggtaaactgcgcacaggcgaggactatctgcagaatctgcgcgatggccgctgtgtc
tatgtgaatggcgagcgggtcaaggacgtgacgacccacccagccttttcgcggggtgct
cagtcactcgcgaacctctatgacattgctgcggcgccggaaaatcgcgaacgtatgacc
tttacgtcgcctacgtccggaaatccggtgctgcgtgcttaccaaattccgaagacgcac
gaggaccttcgtgcgaagcgactggcttcggagatgtggtccgaagcgactttcgggctc
atggggcgctctcccgatcacgtatccaacttctttgtgggttacgcagcggtccccagt
gttttcgccgcgggcggtcaggagtacgccgacaatgtggtgagcttctatgagcatctg
cgcgaaaaccacctttacacgacctatgcaatcgttccgccgcagattgaccgaagcaag
ccagcccatcaacaaagcgatccgacgctctatgccggcgtggtcaaggagcgcgatgac
ggcatcatcatcaagggtgcccagcaactggccaccgctggcgtgtactcagactacatc
tacgtcagtagcatccatccgatgcaacctggcgatgagaactatgcatttggcgtcgcc
atccctgccaacgcgcctggcgtaaagctttacccgcgccgccccttcggcgcgctggcg
acgaactcgttcgactatccgctttccagccgtttcgatgagtcggactgctttgtggtc
ttggacaacgtgtttgtgccatgggagcacgtattcatctaccgaaacctgcaagttgca
cgggatcaatggtggaagacaccggcacacctctacggcaatctgcaagctcaggcccgg
tacattacgaagcttcgcttcatgatgggcctagccaagcggatgaacgagatgaccgga
aacgacgccaatcctgcagtgcagatccaaatgggtgagcttgcttctctggtgtccatc
atcgagcacgcgctgatctcgcaagaagtggcggcgacgacagacgcaaatggtgtgctg
tggccgtcgcggactgggctgtattccatcatggcgcttcaatcggaactgaatgcgcgc
atggtcgagatcatccgcgaactgagcggtgccgggatgatcacgttgccgtcctctgtc
gaagatttccgcaatcccgagactgccgaggatgttcagcgttactacgcctcctcatcg
agcgacgccaaggagcgcgtggcgctgatgcgcatggcctgggacttcatcggttccgag
tttggcaaccgtcaccagcaatatgagaagttctacggtggtgcatccttcctggtcaaa
cagaacgtacaccgtcacttcgattatgatcgatcgaagaagatggtcgagagtgctctg
gcgctgccggcgttctccaacgtgccgtcgaagttcctatga

DBGET integrated database retrieval system