KEGG   Rhodococcus fascians: A3L23_03490
Entry
A3L23_03490       CDS       T04328                                 

Gene name
aam_3
Definition
(GenBank) Acylamidase
  KO
K19795  ureidomalonase [EC:3.5.1.95]
Organism
rfa  Rhodococcus fascians
Pathway
rfa00240  Pyrimidine metabolism
rfa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rfa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    A3L23_03490 (aam_3)
Enzymes [BR:rfa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.95  N-malonylurea hydrolase
     A3L23_03490 (aam_3)
SSDB
Motif
Pfam: Amidase
Other DBs
NCBI-ProteinID: AMY54815
UniProt: A0A165MEY6
LinkDB
Position
complement(3634824..3636272)
AA seq 482 aa
MATTVGPAAELLMSDAVELSGKIKRREVSCVETMTAYLDHIEAHNPTVNAIVALRDRDDL
LAEARERDRQLSDGQYLGWMHGFPHAVKDLSAARGLPFTSGSPIFADRIAEADDLFVARV
KAAGAIVIGKTNTPEFGFGSQTYNPVYGTTVSPYDTSRTAGGSSGGAAAALALRMLPVAD
GTDYMGSLRNPAAFNNVVGFRPSWGRIPEPGFIAQGAVAGPMGRSVTDVAHLLSTMAGPD
ANAPLGIDEDPEIFTRTLERSFRGARIAWVGDWNGHLATEPGVLDLCESSFTVFEDLGCA
VESTVPSYDPAKIWDSFLTWRWWAQLGMADLYENPRTRELMKPEMLWEMEHAVALTALDV
TKAAQARNDWQSALTTLFETYDFVLAPTAQVFPFDKDQHWPQSIAGRPMDTYHRWMETVV
PWTMTGVPAAAVPVGFDDRGLPMGVQIIGRHGADRAVLQLAYAYEQASRWVERVLPPALH
VG
NT seq 1449 nt   +upstreamnt  +downstreamnt
atggcaaccaccgtcggacccgctgccgaacttctgatgtccgacgcggtcgagctcagc
ggcaagatcaagcgccgcgaagtctcgtgcgtcgagaccatgacggcgtacctcgaccac
atcgaggcacacaacccgacggtcaatgccattgtcgccctgcgtgatcgcgacgacctg
ctggccgaggcacgcgagcgagatcggcagctctcggacgggcagtatctcgggtggatg
cacggatttccccatgcggtcaaggatctgtcggcagcccgagggctaccgttcacatcg
gggtcaccgatctttgccgatcgcatcgccgaggcggacgatctgttcgtcgcccgcgtg
aaagcggccggtgccatcgtgatcggcaagaccaacacaccggaattcgggttcggatct
cagacgtacaacccggtgtacggaaccaccgtctcgccctacgacacctcgcgcactgca
ggcggaagcagcggaggtgcggcggcagcattggccctgcgcatgctgcccgtcgccgac
ggcaccgactacatgggatcgctgcgcaaccccgcagccttcaacaatgtggtcggtttt
cgcccgtcgtggggacgcattcccgagccgggcttcatcgctcagggcgcggtcgccgga
ccgatgggccgatcggtcaccgatgtcgcacatctgctgtcgacgatggcgggcccggat
gccaacgcgcccctcggaatcgacgaggatccggagatcttcacccgcactctcgaacgc
agcttccgcggtgcccgcatcgcgtgggtcggagactggaacggtcacctggctaccgaa
cccggtgtcctcgatctgtgcgagtcgtcgttcaccgtcttcgaggacctcggctgcgca
gtggagagcaccgtgccgtcgtacgacccggcgaaaatctgggactcgttcctgacgtgg
cggtggtgggcgcagctcgggatggccgatctgtacgagaacccgcgcacgagggagctg
atgaagcccgaaatgctgtgggagatggagcatgccgtcgcattgaccgcactcgatgtc
accaaggcagcgcaggctcgcaacgactggcagagcgcactgacgacattgttcgagacc
tacgacttcgttctcgcgcccaccgctcaggtgttcccgttcgacaaggaccaacattgg
ccgcagtccatcgcgggtcgacccatggacacctatcaccggtggatggaaacggtggtg
ccctggacgatgaccggtgttcctgccgccgccgtcccggtcgggttcgacgatcgcggt
ctgccgatgggtgttcagatcatcggcaggcacggtgccgaccgggcggttctgcagctc
gcctatgcctacgagcaggcctcgcggtgggtcgagcgcgttctcccgccggcactgcac
gtcggctga

DBGET integrated database retrieval system