KEGG   Rhinolophus ferrumequinum (greater horseshoe bat): 117019453
Entry
117019453         CDS       T07722                                 
Symbol
ITGAX
Name
(RefSeq) integrin alpha-X
  KO
K06462  integrin alpha X
Organism
rfq  Rhinolophus ferrumequinum (greater horseshoe bat)
Pathway
rfq04610  Complement and coagulation cascades
rfq04810  Regulation of actin cytoskeleton
rfq05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:rfq00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    117019453 (ITGAX)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    117019453 (ITGAX)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    117019453 (ITGAX)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:rfq04515]
    117019453 (ITGAX)
   04090 CD molecules [BR:rfq04090]
    117019453 (ITGAX)
Cell adhesion molecules [BR:rfq04515]
 Integrins
  Integrin alpha subunits
   117019453 (ITGAX)
CD molecules [BR:rfq04090]
 Proteins
  117019453 (ITGAX)
SSDB
Motif
Pfam: Integrin_alpha2 VWA FG-GAP VWA_2 VWA_CoxE Integrin_alpha FG-GAP_2
Other DBs
NCBI-GeneID: 117019453
NCBI-ProteinID: XP_032957028
Ensembl: ENSRFEG00010020544
LinkDB
Position
15
AA seq 1160 aa
MANTGTSLFLLTALGSSVCFNVDTDTPTIFSMDGAGFGHSVAQYSNSRVVVGAPQEIRAT
DQTGGLYQCDYRTGTCEPIHLQVPREAVNMSLGLSLTAATKPFQLLACGPTVHQTCRENV
YLTGFCFFLVPRSWQPQKLPSALQECPRQEQDIVFLIDGSGSINFRDFAKMLTFVKAVMS
QFQRPSAQFSLMQFSDRFREHFTFKEFMDSSDPLGLLDSVYQLRGYTHTATAIQRATKVL
FSALKGARKDASKILIVITDGEKTGDHLSYADVIPRAEAAGVLRYAVGVGSAFQNRVSWK
ELIDIASRPSQEYIFQVENFDALRDIQNQLKEKIFAIEGTKTSRSSSFELEMSQEGFSAV
LTPDGPVLGAVGSFGWSGGAFLYPPNANPTFINMSQEHEDMRDSYLGYATELALWKGVQS
LVLGAPRHQHTGKVVIFTQASRQWKPKAEVTGTQIGSYFGASLCSVDVDRDGSSDLVLIG
APHYYELTRGGQVSVCPLPRGRAKWQCDVILRGEQGHPWGRFGAALTVLGDVNGDRLTDV
AIGAPGEQENSGAVYLFRGATGLGISPSHSQRIAGSQLSPRLQYFGQSLSGGQDLTMDRL
VDLAVGARGHALLLRTRPVLWVHASIRTSPTEISRSMSECREQTPSFQTLGDATVCLHVY
ESTKTQLGNLESSVTFDLTLDPGRLSPRAIFKETRARYLTRTLDLGLRQHCEDVALLLSA
CVEDSVTPVILRLNFSLVGKPILSFGNLQPMLDVDAPRYFTTSLPFEKNCGADHVCQDDL
GISFGRSGLKSLVVGTHLELTTEVTLCNDGEDSYGTTVTFSYPLGLSYRRVAGSQNQGQL
RSLPLTCDSSSAGSQGARSTHCSIKHVIFREGAQITFTATFDVSPKAELGDRLRLTANVS
SENNSPRTSKSTSQLELPVKYAIYVVISSHEESTKYVNFSASEEKESSVAQHRYQVNNLG
SRDLPVSINFLVPTELNQVPVWTDIEVSHPQNPSIQCSSQRTAPTESNFLTHIQENRVLN
CSIADCLRFRCDVPSFGIQEELDFILKGNLSFGWVSQTLQKKVLVVSVAEITFDTSVYSQ
FPGQEAFLRAQMGTVLEEYAIHNPVPLIVGSSVGGLLLLALITATLYKVGFFKRQYKEMM
EEANGQTAPENATPNPQVAQ
NT seq 3483 nt   +upstreamnt  +downstreamnt
atggccaacaccgggacgtcccttttcctgttgacggcattggggtcctctgtctgcttc
aacgtggacacggacacgccgacaatcttctccatggacggggctgggttcggacacagc
gtggcccagtactccaactccagggtggtggttggagccccccaggagataagggctacc
gaccaaacaggcggtctctaccagtgtgactacagaacgggcacctgtgagcccatccac
ctgcaggtcccccgggaggctgtgaacatgtcgctgggcctgtccctgacagctgccacc
aaaccctttcagctgctggcctgtggccctactgtgcatcagacatgcagggagaacgtg
tacttgaccgggttctgcttcttcctggtcccccgctcctggcagccccagaagctccct
tctgccctgcaggagtgcccgaggcaggagcaggacatcgtgttcctgattgacggctca
gggagcatcaactttcgtgacttcgccaagatgctgaccttcgtcaaggccgtgatgagc
cagttccagagacccagcgcccagttctccctgatgcagttctctgaccgattccgggag
cacttcacgttcaaagagttcatggacagctcagacccactaggcctgctggattccgtg
taccagctgagaggatacactcacacggccacagccatccagagggccacaaaagtgctg
ttcagtgccttaaaaggggcccgaaaggatgcctcaaagattctcatcgtcatcaccgac
ggagagaagaccggcgaccacctgagttatgctgacgtcatcccccgggcggaggcggct
ggcgtcctccgttacgcggtcggggtggggtcggcttttcagaacagagtttcctggaaa
gaattaattgacatcgcatcgcgcccttcccaagagtatatatttcaagtggagaacttc
gatgctttgagagacattcagaaccaactgaaagagaagatcttcgccattgagggtacg
aagacctcaagaagcagttccttcgagttggagatgtcccaggagggctttagcgctgtg
ctcacacctgatggacccgttttgggggctgtggggagcttcggctggtctggaggggcc
ttcctgtaccccccaaatgcaaaccccaccttcatcaacatgtctcaggagcatgaggac
atgagggactcttacctgggttacgccaccgaactggcgctctggaagggggtacagagc
ctggtcctgggagccccccgccatcagcacactgggaaggtggtcatcttcacccaggcg
tccaggcaatggaagccgaaggctgaagtcacagggacccagatcggctcctactttggg
gcctccctctgctccgtggacgtggacagagatggcagctccgacctggtcctcatcggg
gctccccattactatgagctgactcgggggggccaggtgtctgtgtgccccttgccccgg
gggagggctaagtggcagtgtgacgtcattctccgtggggagcagggccacccctggggc
cgctttggggcagccctgaccgtgctgggggacgtgaatggggacaggctgaccgatgtg
gccatcggggccccgggggagcaggagaactcaggtgctgtctacctgttccgtggagcc
acaggtctgggcatcagcccctcccacagccagaggattgcaggctcccagctgtccccc
aggctccagtattttgggcagtcactgagcgggggtcaggacctcacaatggacagactg
gtggacctggccgtgggggcccgggggcacgcactgctgctcaggaccaggcctgtgctc
tgggtgcatgcaagcattcgcacctcgccgacagagatttctaggtccatgtctgagtgt
cgggagcagacgccctctttccagacactgggtgatgccactgtttgccttcatgtttat
gaaagtaccaagacccagctgggtaacctcgaaagctctgtgacctttgacctgaccctc
gatcctggccgcctgagtccccgtgccatcttcaaggagaccagggctcggtacctgact
cgcactctagaccttgggctgagacagcactgtgaggacgtggcgttgctcctctcggcc
tgtgtggaggactctgtgacccccgtcatcttgcgtctcaatttctccctggtgggcaag
cccatcctttcgtttgggaacctccagccgatgctggatgtggatgcccccagatacttc
acgacctctctcccctttgagaagaactgtggagccgaccacgtctgccaggacgacctt
ggcatctcctttggccgctcaggcttgaagtccctggtagtggggactcacctagagctg
accacggaggtgacactgtgtaatgatggcgaggactcgtatggaaccacagtcaccttc
tcctatccactggggctgtcttatcgacgagttgcaggaagccagaaccaagggcagttg
cgctccctgcccctgacctgcgacagctcctctgcggggagccagggagcgcggagcacc
cactgcagcatcaaacacgtcatcttccgcgagggggcccagatcaccttcacagccacc
tttgacgtctcccccaaggccgagctgggagaccggctgcgtctgacggccaatgtgagt
agtgagaataattcccccagaaccagcaagagcacctcccagctggagctccctgtgaag
tatgccatctacgtggtgatcagcagccatgaagagtccaccaagtatgtcaacttctca
gcctcggaggagaaagaaagcagcgtggcccagcacagataccaggtcaacaacctgggg
tccagggatctgcctgtcagcatcaacttcctggttcctacggagctgaaccaggtgcct
gtgtggacagacatcgaggtctcccacccccagaacccgtcgattcagtgctcttcacag
agaacagcgcccacagagtccaacttcctgacccacattcaggagaaccgtgtgctgaac
tgctccatcgctgactgcctgaggttccgctgtgacgtcccctccttcggcatccaggag
gaacttgacttcatcctgaagggcaacctcagcttcggctgggtcagccagacactgcag
aagaaggtcttggtggtgagtgtggctgaaatcacgttcgacacatctgtgtattcccag
ttcccaggacaggaggcgtttttgagagcccagatggggacggtgctagaggagtacgcg
atccataacccggtgcccctcatcgtgggcagctctgtggggggcctgctgttgctggct
ctcatcacggccacactgtacaaggttggcttcttcaaacgtcagtacaaggaaatgatg
gaggaagcaaatggacagactgccccagaaaatgcaacaccaaatccccaagttgcccaa
taa

DBGET integrated database retrieval system