KEGG   Rhinolophus ferrumequinum (greater horseshoe bat): 117026756
Entry
117026756         CDS       T07722                                 
Symbol
TNFRSF8
Name
(RefSeq) tumor necrosis factor receptor superfamily member 8
  KO
K05145  tumor necrosis factor receptor superfamily member 8
Organism
rfq  Rhinolophus ferrumequinum (greater horseshoe bat)
Pathway
rfq04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:rfq00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    117026756 (TNFRSF8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:rfq04050]
    117026756 (TNFRSF8)
   04090 CD molecules [BR:rfq04090]
    117026756 (TNFRSF8)
Cytokine receptors [BR:rfq04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   117026756 (TNFRSF8)
CD molecules [BR:rfq04090]
 Proteins
  117026756 (TNFRSF8)
SSDB
Motif
Pfam: TNFR_c6
Other DBs
NCBI-GeneID: 117026756
NCBI-ProteinID: XP_032969657
Ensembl: ENSRFEG00010008019
LinkDB
Position
9:8223826..8274331
AA seq 490 aa
MYCATTAINSCARCFPHSICPTGMIVKFPGTAERDTVCELPSPGASPDCSTSPEDCKAPA
SGTTLQAKSIRTSASSDARTTLLGGGPPFTPENYSKMTRDPSSPPSMGKPSLDPGPAPQL
CLQGSSDCRKQCDQDYFLDRDGRCKACVSCSGGDLVEKTPCTWNSSRVCECRPGMVCVTS
ATNSCARCVACPIFPPGTAEKDTTQEPPSPGTHLNCSTKPEDREAPSSLTSCLSPCSTTL
YLAESQTSEGRGEGITHARGDASISTSAPISFSSMGRPLLVSEPVLWLIVLLLVVIGSSS
FLLCHRRACRKWIRQKLHLCYPVQTFRPKPDPVDSMPQRNTILMKSTVTEPCTKELGLMS
PPAVETCPNVGATSLESLRLLDASPDDSPLSPRDLPEPRVTTEHTNNKIEKIYIMKADTV
IVGTVKTEVPEGRSLAAPAAPELEDDLEMDHAPHYPEQETEPPLGSGRDVMFSVEEEGKE
DPSPTTASGK
NT seq 1473 nt   +upstreamnt  +downstreamnt
atgtactgtgccacaaccgccatcaactcctgtgcccgctgcttcccccactccatctgc
cccacagggatgattgtcaagttcccaggtacagcggagagggacactgtctgtgagctg
ccttccccaggagccagccctgactgcagcaccagcccagaggactgcaaggcccccgcc
agtggcaccaccctccaggccaaatccatccggacctcggcaagctccgatgccaggacc
acacttctcggagggggccctcccttcaccccggaaaattattccaaaatgacgagggat
cccagctctcccccctccatggggaagcccagcctggatccagggccggccccgcagctg
tgcctgcaggggtcatctgactgcaggaagcagtgtgatcaggactatttcctggatagg
gacggtcgctgcaaggcctgtgtgagctgttcaggaggtgacctcgtggagaagacacct
tgcacgtggaactcctcccgcgtctgtgaatgtcgaccgggcatggtctgtgtcacatca
gccaccaactcctgtgcccgctgcgtcgcttgtcccatcttcccaccaggtacagctgag
aaggacaccacccaggagccgccttccccggggacccaccttaactgcagcaccaagcca
gaggaccgtgaggcaccttccagtctcacctcttgcttgtctccctgtagcaccaccctc
tatctggcagagtcccagaccagtgagggacgtggagagggcattacccacgcccggggg
gatgcgtccatctcaacaagtgctcccatctctttctcctccatgggaaggccccttctg
gtttcagaacccgtgctctggttgatcgtgctgctgctggtggtgattggctccagctcc
ttcctcctgtgccaccggagggcgtgccggaagtggattcggcagaagctccacctctgc
tacccagtccagaccttccggcccaagccggaccccgtggattccatgcctcagaggaac
acgatactgatgaaaagcactgtgacagaaccctgcacaaaggagctggggttaatgagc
cccccggctgtggagacctgccccaatgtgggggcaacctccctggagagcctgcggctg
ctggatgccagcccagatgacagccccttgtcccccagggaccttcctgagccccgagtg
accacggagcataccaataacaagatcgagaaaatctatatcatgaaggcggacacggtg
attgtggggactgtgaagactgaggtgcctgagggccggagcctggcggcaccggcagca
cctgagcttgaggacgatctggaaatggaccatgccccccactacccggagcaggagaca
gaaccacctctgggcagcggtagggacgtcatgttctcggtggaggaggaaggaaaggag
gacccctcgcccacaactgcctctgggaaatga

DBGET integrated database retrieval system