KEGG   Rhodococcus koreensis: JWS14_43570
Entry
JWS14_43570       CDS       T07497                                 
Name
(GenBank) phosphoenolpyruvate-utilizing protein
  KO
K21787  prodigiosin/undecylprodigiosin synthetase
Organism
rko  Rhodococcus koreensis
Pathway
rko00333  Prodigiosin biosynthesis
rko01100  Metabolic pathways
rko01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rko00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    JWS14_43570
SSDB
Motif
Pfam: PEP-utilizers
Other DBs
NCBI-ProteinID: QSE85952
LinkDB
Position
unnamed1:complement(559983..561725)
AA seq 580 aa
MVDINKPWVVDSRLSERFTVYTRGNAGEVAGMVASPLQQTVISGWRSETAWRQALIDFGA
FDDCEFSPDSLDIIGVAHGYIYINLSIQRVFGVRMPGASAELMDRTYLGSSTGAPEYVEQ
PGDSAPQYAERIGASIGRVMGTTSRPDLEADAQRALELRRARPDYSAMSDHELVAYSNRV
NDEYTADFLRKHMLMMYESSIVTGFLDETLGRFDDSTLGVRLMGGWGGVASAAPAIELWR
IGRLAAASELVTKEFEVGVDGVLDRLRSRGEVEARSFVEQFDGFIFEYGSRSSQEWDIFP
PDWESHPEMVATLVNQFRKLPQDSSPEATGKKVSQGREALLEELRVRLADDAEGWGQLQA
AVAALSVWMPARELSKTNFIKALHETRLPLRELGKRFADRGVLESFDDLALLRLDEVSAL
IDDPSVVSVIAERKEWIAELERREPPFVVVAGDVPSPTTWEQRTGPSALPVAGPGETLSG
LGACPGSATGVARVIMDPSEAEELEPGEILVAPETDPGWTPLFTTCAGVVVNVGSPLSHA
AIVSRELGIPAVLAVEQATKRIKSGTLLTVDGTTGTVTVH
NT seq 1743 nt   +upstreamnt  +downstreamnt
atggttgacatcaacaagccctgggtggtcgacagtcgcctgagcgagcgcttcacggtc
tacacccgcggcaatgcgggcgaggtggccggtatggtcgcctcgccgctgcagcagacc
gtgatcagcgggtggcgctcggagaccgcctggcgccaggcgctcatcgacttcggcgcc
ttcgacgactgcgagttcagtccggactcgctcgacatcatcggtgtggcgcacggctac
atctacatcaacctgtccatccagcgagtgttcggcgtccggatgcccggtgcaagtgcg
gaactcatggaccgcacctatctggggtccagcaccggtgcaccggagtatgtggagcaa
ccgggtgacagtgctccgcagtatgccgagcggatcggtgcgagcatcggccgggtcatg
ggcaccacctcgcgtcccgacctcgaggcggatgcgcagcgcgcgctggagttgcgtcga
gcccggcccgattactccgcgatgtccgaccatgaactggtcgcgtactcgaaccgggtc
aacgacgagtacaccgccgacttcctgcgcaagcacatgctgatgatgtacgagtcgtcg
atcgtcaccggattcctcgacgagacactgggccggttcgatgattcgacactcggtgtc
cggttgatgggcggctggggtggggtggcctccgcggcgccggccatcgagctgtggcgg
atcggcaggctggccgcggcctcggagctcgtcaccaaggagttcgaggtcggcgtcgac
ggtgtcctcgaccggctgcgcagccgcggtgaggtcgaggcgaggtccttcgtcgagcag
ttcgacgggttcatcttcgagtacggctcgcgctcgtcgcaggagtgggacatcttcccg
ccggattgggagtcgcatccggagatggtggcgaccctcgtcaaccagttccgcaagctg
ccgcaagacagctcgccggaagccaccggcaagaaggtgtcgcagggccgcgaagcactg
ctcgaggagctgagggttcggctcgccgacgacgccgaaggatggggccagctgcaggcc
gcggtcgcggcgctgtcggtgtggatgcccgcccgcgagctgagcaagaccaacttcatc
aaggcgctgcacgagacccgcctcccgctgcgggagctgggcaagcgcttcgccgaccga
ggtgtcctcgagtccttcgacgacctggcgctgctgcggctcgacgaggtgagcgcactg
atcgacgatccgtcggtggtgtcggtgatcgctgagcgcaaggagtggatcgccgagctc
gaacgccgggagccgcccttcgtcgtggtcgccggtgacgtgccgagtccgacgacgtgg
gagcagcggaccgggccgtcggcgctaccggtggccggtccgggcgagaccctctcgggt
ctgggagcctgcccgggctcggcgaccggcgtggcccgcgtgatcatggacccctcggag
gctgaggagctcgaacccggcgagatcctcgtggctcccgagaccgacccggggtggacg
ccgctgttcaccacctgcgcgggcgtcgtggtcaacgtcggctcgccgctgagtcacgcg
gccatcgtcagtcgtgaactgggcatcccggcggttctcgcggtggagcaggccaccaag
cggatcaagtcgggcacgttgttgaccgtcgacggcacgaccgggacggtgacggtgcac
tga

DBGET integrated database retrieval system