Rhizobium lusitanum: HB780_15470 Help Entry HB780_15470       CDS       T07787                                  Symbol hfq Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism rls  Rhizobium lusitanum Pathway rls02024   Quorum sensing rls03018   RNA degradation Brite KEGG Orthology (KO) [BR:rls00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     HB780_15470 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     HB780_15470 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:rls03019]     HB780_15470 (hfq)    03036 Chromosome and associated proteins [BR:rls03036]     HB780_15470 (hfq) Messenger RNA biogenesis [BR:rls03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      HB780_15470 (hfq) Chromosome and associated proteins [BR:rls03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     HB780_15470 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq Hfq_1 LSM Motif Other DBs NCBI-ProteinID:  QND47122 LinkDB All DBs Position 324054..324296 Genome browser AA seq 80 aa AA seqDB search MAERSQNLQDLFLNTVRKQKISLTIFLINGVKLTGVVTSFDNFCVLLRRDGHSQLVYKHA ISTIMPGQPMQMFESEEVAS NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atggcggaacgttctcagaacttgcaggacctatttcttaatactgttcgcaagcaaaaa atttcactcacaatcttcttgatcaatggcgtgaagctcacgggcgttgttacgtccttc gacaatttctgcgtcctgctacgccgcgacggtcattcgcagcttgtttacaagcacgcg atttcgaccatcatgccgggtcagcccatgcagatgttcgagagcgaagaagtcgcatcc taa

DBGET integrated database retrieval system