KEGG   Rossellomorea marisflavi: D5E69_08585
Entry
D5E69_08585       CDS       T07410                                 
Name
(GenBank) BMP family ABC transporter substrate-binding protein
  KO
K05519  transcriptional activator of comK gene
Organism
rmf  Rossellomorea marisflavi
Brite
KEGG Orthology (KO) [BR:rmf00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rmf03000]
    D5E69_08585
Transcription factors [BR:rmf03000]
 Prokaryotic type
  Other transcription factors
   Others
    D5E69_08585
SSDB
Motif
Pfam: Bmp Peripla_BP_4 DapH_N
Other DBs
NCBI-ProteinID: QHA38414
UniProt: A0A5S4Z832
LinkDB
Position
1627394..1628353
AA seq 319 aa
MKFFHLSMILLLIGGCSAGNRSGEMDNAGLLVPETIDDGVWGTKGYQGLLGIQKEFDVKV
YYKEGMKNDASVRQAIDDFEKEDVNLVFGHGSEYSSIFNEVASEHKDMHLVSFNGDATQK
NTTSLTFKGYAMGFFGGMTAASQTKTDRLGIIAAFSWQPEVQGFIDGARYQNSEAEVLVD
YTGHWDHAEVALERLDGLLDQDVDVVYPAGDGYNVAVIEKLKESGRYAIGYVSDQSDLGE
STVLTSTVQHADKLYELIAGKYTAGELESGNLEFDFQDGVISMGEFSPVIPDGFKSEMNQ
HIKAYVDTGKLPNGKEPPL
NT seq 960 nt   +upstreamnt  +downstreamnt
atgaaattttttcacttgtcgatgatcctgttgctcatcgggggctgctctgccggtaac
cggtcaggagagatggataatgccggtctgcttgtaccggaaacgattgatgacggcgtt
tggggaaccaagggctatcaaggtcttttaggcatccagaaagagttcgatgtgaaggtt
tattataaagaaggcatgaagaacgatgcatcggtccgtcaagccatagatgactttgaa
aaggaagacgtcaatcttgttttcggacatgggagtgagtattcttccatattcaatgag
gtggcatcagagcataaagacatgcatctggtgagcttcaacggggacgccacgcagaaa
aatactaccagcctgactttcaaaggctacgctatgggcttctttggagggatgacggcg
gcttcccagaccaagacggatcgactcggcatcattgccgccttttcctggcagccggaa
gtacaggggttcattgatggagccagataccaaaacagtgaagcagaggttctggtcgat
tatacaggtcactgggatcatgccgaggttgccctcgaaaggctcgacggactcctcgac
caggatgtggacgttgtatatcctgctggggacgggtataatgtggctgtaattgaaaag
ctcaaggaatcaggccggtatgcgatcgggtatgtgagcgaccaatcagaccttggggaa
tcaacggtgctgacgagtacggtccagcatgccgacaaattgtatgaattgattgccggg
aaatatacagccggtgagcttgagtcgggtaatcttgaattcgacttccaggacggggtc
atctccatgggagaattcagccctgtaatccctgatggattcaagagcgaaatgaaccag
catatcaaagcatatgtcgataccgggaaactaccgaacggaaaggagccgccactatga

DBGET integrated database retrieval system