Roseivivax marinus: LVO79_14315 Help Entry LVO79_14315       CDS       T08313                                  Name (GenBank) F0F1 ATP synthase subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism rmh  Roseivivax marinus Pathway rmh00190   Oxidative phosphorylation rmh01100   Metabolic pathways Module rmh_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:rmh00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     LVO79_14315  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:rmh00194]     LVO79_14315 Photosynthesis proteins [BR:rmh00194]  Photosystem and electron transport system   F-type ATPase [OT]    LVO79_14315 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C PC_rep Motif Other DBs NCBI-ProteinID:  UMA64182 LinkDB All DBs Position complement(3026148..3026372) Genome browser AA seq 74 aa AA seqDB search MEGQLAHIGAGLAGLGCGLSALGVGNVAANYLSGALRNPSAAASQTATLFIGIAFAEALG IFSFLVALLLMFAV NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atggaagggcaactcgcacacatcggcgcaggtcttgctggtctcggctgcggcctctcg gcactcggcgtcggcaatgtcgccgcgaactacctctcgggcgccctgcgcaacccctcg gctgccgcttcgcagaccgcgacgctcttcatcggcatcgccttcgcggaagccctgggc atcttctcgttcctcgtcgccctgctgctgatgttcgcggtctga

DBGET integrated database retrieval system