Roseovarius mucosus: ROSMUCSMR3_00101 Help Entry ROSMUCSMR3_00101  CDS       T04779                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism rmm  Roseovarius mucosus Pathway rmm01100   Metabolic pathways rmm01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rmm00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ROSMUCSMR3_00101   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ROSMUCSMR3_00101 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF1493 Motif Other DBs NCBI-ProteinID:  ARE81612 UniProt:  A0A1V0RJ46 LinkDB All DBs Position 105496..105762 Genome browser AA seq 88 aa AA seqDB search MSHDTQDLEQEILDVLFERLSKFPVKSGALSADTSLVADMNLDSVNMMELLMEVEDTFDV SFPLNMMANVDTVQNLADQIKLLVEKKS NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atgtcacatgacacccaagaccttgaacaggaaatcctcgacgtgctgttcgagcgcctg tcgaaattcccggtgaaatccggcgcattgtctgcggacaccagccttgtcgccgatatg aaccttgattccgtcaatatgatggaattgctgatggaggttgaggacacctttgacgtc agctttccgctcaacatgatggccaatgtcgatacggtgcagaaccttgccgatcagatc aaactgcttgtggagaaaaaatcatga

DBGET integrated database retrieval system