Roseomonas mucosa: FOB66_02585 Help Entry FOB66_02585       CDS       T06208                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism rmuc  Roseomonas mucosa Pathway rmuc00998   Biosynthesis of various antibiotics rmuc01100   Metabolic pathways rmuc01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rmuc00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     FOB66_02585   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     FOB66_02585 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  QET91808 LinkDB All DBs Position 2:complement(267486..267737) Genome browser AA seq 83 aa AA seqDB search MLDERAALREITAALEETGKLTGPVTMDTNILKDLNFDSVGAVDFIMVLETRLDIIIPMD RMTEIETIGDLVRVVTSDPSLAS NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgctggatgagcgggccgccctacgggaaatcaccgcggccttggaagagacggggaag ctgacaggccccgtcaccatggacacgaacatcctcaaggacctgaatttcgactccgtg ggtgccgtcgatttcatcatggtgctggagacccgtctggacatcatcatcccgatggac cggatgacggagatagagaccatcggcgacctcgtccgggtcgtgaccagcgatcccagc ctggcctcctga

DBGET integrated database retrieval system