KEGG   Rattus norvegicus (rat): 100145871
Entry
100145871         CDS       T01003                                 

Gene name
Adh5
Definition
(RefSeq) alcohol dehydrogenase class-3
  KO
K00121  S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00010  Glycolysis / Gluconeogenesis
rno00071  Fatty acid degradation
rno00350  Tyrosine metabolism
rno00620  Pyruvate metabolism
rno00830  Retinol metabolism
rno00980  Metabolism of xenobiotics by cytochrome P450
rno00982  Drug metabolism - cytochrome P450
rno01100  Metabolic pathways
rno01200  Carbon metabolism
rno05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100145871 (Adh5)
   00620 Pyruvate metabolism
    100145871 (Adh5)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    100145871 (Adh5)
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    100145871 (Adh5)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100145871 (Adh5)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100145871 (Adh5)
   00982 Drug metabolism - cytochrome P450
    100145871 (Adh5)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    100145871 (Adh5)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     100145871 (Adh5)
    1.1.1.284  S-(hydroxymethyl)glutathione dehydrogenase
     100145871 (Adh5)
SSDB
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C UDPG_MGDP_dh_N 2-Hacid_dh_C
Other DBs
NCBI-GeneID: 100145871
NCBI-ProteinID: NP_001119592
RGD: 2292706
Ensembl: ENSRNOG00000046357
UniProt: P12711
LinkDB
Position
2
AA seq 374 aa
MANQVIRCKAAVAWEAGKPLSIEEIEVAPPQAHEVRIKIIATAVCHTDAYTLSGADPEGC
FPVILGHEGAGIVESVGEGVTKLKAGDTVIPLYIPQCGECKFCLNPKTNLCQKIRVTQGK
GLMPDGTSRFTCKGKPILHFMGTSTFSEYTVVADISVAKIDPSAPLDKVCLLGCGISTGY
GAAVNTAKVEPGSTCAVFGLGGVGLAVIMGCKVAGASRIIGIDINKDKFAKAKEFGATEC
INPQDFSKSIQEVLIEMTDGGVDFSFECIGNVKVMRSALEAAHKGWGVSVVVGVAASGEE
ISTRPFQLVTGRTWKGTAFGGWKSVESVPKLVSEYMSKKIKVDEFVTGNLSFDQINKAFD
LMHSGNSIRTVLKM
NT seq 1125 nt   +upstreamnt  +downstreamnt
atggcgaaccaggtgatcaggtgtaaggctgcagtcgcctgggaggccggaaagcctctc
tccatagaggagatagaggtggcccctccacaggctcatgaagttcgaattaagatcatt
gccactgctgtttgccacaccgatgcctataccctgagtggagctgatcctgaggggtgt
ttccccgtgatcttaggacatgaaggcgctggcattgtggagagtgttggcgaaggggtt
actaagctgaaggcaggtgataccgtcatcccgctgtacatcccacagtgtggagaatgc
aagttctgtctgaatcctaaaacaaacctttgccagaaaataagagtcactcaggggaaa
gggttgatgcccgatgggaccagcaggtttacctgcaaagggaagcctattcttcacttc
atgggaaccagcacgttttccgagtacacagtggtggcagacatctctgttgctaaaatt
gacccttccgcccctttggataaagtctgccttctcggttgtggcatttcaactggctac
ggggccgctgtgaacactgccaaggtggagcctggttctacctgtgccgtctttggcctg
ggaggagttggattggcggtgatcatgggctgtaaagtggctggtgcgtcccggatcatt
ggtattgacatcaataaagataaattcgcgaaggccaaagaatttggagccactgaatgt
attaacccccaagatttcagtaaatccatccaggaagtcctcatcgagatgacagatggc
ggagtggacttctcctttgagtgtatcggtaacgtgaaggtcatgagatcagccctcgag
gcagcccacaaaggctggggtgtcagtgtggtggttggtgtggccgcttcaggtgaagaa
atctccactcgtccgttccaactggtgacaggacgcacgtggaaaggcactgcctttgga
ggctggaagagtgtggagagtgtcccgaagctggtgtctgaatatatgtccaaaaagata
aaagttgacgaatttgtgactggcaatctgtccttcgaccagattaacaaagcctttgat
ctgatgcactcgggaaacagcattcgaactgttctaaagatgtaa

KEGG   Rattus norvegicus (rat): 171178
Entry
171178            CDS       T01003                                 

Gene name
Adh7
Definition
(RefSeq) all-trans-retinol dehydrogenase [NAD(+)] ADH7
  KO
K13951  alcohol dehydrogenase 1/7 [EC:1.1.1.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00010  Glycolysis / Gluconeogenesis
rno00071  Fatty acid degradation
rno00350  Tyrosine metabolism
rno00620  Pyruvate metabolism
rno00830  Retinol metabolism
rno00980  Metabolism of xenobiotics by cytochrome P450
rno00982  Drug metabolism - cytochrome P450
rno01100  Metabolic pathways
rno05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    171178 (Adh7)
   00620 Pyruvate metabolism
    171178 (Adh7)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    171178 (Adh7)
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    171178 (Adh7)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    171178 (Adh7)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    171178 (Adh7)
   00982 Drug metabolism - cytochrome P450
    171178 (Adh7)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    171178 (Adh7)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     171178 (Adh7)
SSDB
Motif
Pfam: ADH_N ADH_zinc_N UDPG_MGDP_dh_N
Other DBs
NCBI-GeneID: 171178
NCBI-ProteinID: NP_599156
RGD: 621638
Ensembl: ENSRNOG00000032959
UniProt: P41682
LinkDB
Position
2
AA seq 374 aa
MDTAGKVIKCKAAVLWGTNQPFSIEDIEVAPPKAKEVRVKILATGICGTDDHVIKGTMVS
KFPVIVGHEAVGIVESVGEEVTTVRPGDKVIPLFLPQCRECNPCRNPEGNLCIRSDLTGR
GVLADGTTRFTCKDKPVQHFMNTSTFTEYTVLDESSVAKIDAEAPPEKACLIGCGFSTGY
GAAVKTAKVSPGSTCAVFGLGGVGLSVVMGCKAAGASRIIGIDINKDKFQKALDVGATEC
INPRDFTKPISEVLSDMTGNTVQYTFEVIGRLETMVDALSSCHMNYGTSVVVGAPPSAKM
LSYDPMLLFTGRTWKGCVFGGWKSRDDVPKLVTEFLEKKFDLGQLITHTLPFHNISEGFE
LLYSGQSIRTVLTF
NT seq 1125 nt   +upstreamnt  +downstreamnt
atggacactgctggaaaagttattaagtgcaaagcagctgtcctatgggggacgaaccag
cccttctccattgaggacattgaagtggccccaccaaaggctaaggaagttcgtgttaag
attttggccacgggaatctgtggcacagatgaccacgtgatcaagggaacgatggtgtct
aagttcccagtgattgtgggacacgaagcagttgggattgtggagagtgttggagaagag
gtcactacagtgagaccaggtgacaaagtgatccccctctttctaccacagtgtagagaa
tgcaacccctgccgcaacccggagggaaatctctgcattaggagcgacctgacaggccgt
ggagtattggctgacggcacgaccaggttcacatgcaaggacaaaccagtccagcacttc
atgaacaccagcaccttcactgagtacacggtcctggatgaatcctccgtagctaagatc
gatgccgaggctcctcccgagaaagcctgcttgattggctgtggattttccactggttat
ggggctgctgttaaaactgccaaggtcagccctggctccacctgtgctgtgtttggcctg
ggaggagttggcctgtcagtcgtcatgggctgtaaagcggccggcgcctcccggatcatc
ggaattgacatcaacaaggacaaatttcagaaagccctggatgtaggggccacagagtgt
atcaatcccagggacttcaccaagcccatcagtgaggtgctgtcagacatgacaggcaac
actgtccagtatacttttgaagttatcgggcgccttgagaccatggttgatgccctctca
tcttgccatatgaactacgggaccagcgtggtggtcggggctcctccgtcagccaagatg
ctcagctatgacccaatgctgcttttcactggacggacatggaagggctgcgtctttggt
ggttggaagagcagagatgatgttcccaaattggtgactgaattcctggaaaagaaattt
gacctgggccagttgataacccacaccttgccttttcataacatcagtgaaggatttgaa
ttgctttattcagggcaaagcattcggactgtcctgacattttga

KEGG   Rattus norvegicus (rat): 24172
Entry
24172             CDS       T01003                                 

Gene name
Adh1
Definition
(RefSeq) alcohol dehydrogenase 1
  KO
K13951  alcohol dehydrogenase 1/7 [EC:1.1.1.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00010  Glycolysis / Gluconeogenesis
rno00071  Fatty acid degradation
rno00350  Tyrosine metabolism
rno00620  Pyruvate metabolism
rno00830  Retinol metabolism
rno00980  Metabolism of xenobiotics by cytochrome P450
rno00982  Drug metabolism - cytochrome P450
rno01100  Metabolic pathways
rno05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    24172 (Adh1)
   00620 Pyruvate metabolism
    24172 (Adh1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    24172 (Adh1)
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    24172 (Adh1)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    24172 (Adh1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    24172 (Adh1)
   00982 Drug metabolism - cytochrome P450
    24172 (Adh1)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    24172 (Adh1)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     24172 (Adh1)
SSDB
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C UDPG_MGDP_dh_N TrkA_N 2-Hacid_dh_C
Other DBs
NCBI-GeneID: 24172
NCBI-ProteinID: NP_062159
RGD: 2044
Ensembl: ENSRNOG00000012436
UniProt: P06757
LinkDB
Position
2
AA seq 376 aa
MSTAGKVIKCKAAVLWEPHKPFTIEDIEVAPPKAHEVRIKMVATGVCRSDDHAVSGSLFT
PLPAVLGHEGAGIVESIGEGVTCVKPGDKVIPLFSPQCGKCRICKHPESNLCCQTKNLTQ
PKGALLDGTSRFSCRGKPIHHFISTSTFSQYTVVDDIAVAKIDAAAPLDKVCLIGCGFST
GYGSAVQVAKVTPGSTCAVFGLGGVGLSVVIGCKTAGAAKIIAVDINKDKFAKAKELGAT
DCINPQDYTKPIQEVLQEMTDGGVDFSFEVIGRLDTMTSALLSCHSACGVSVIVGVPPSA
QSLSVNPMSLLLGRTWKGAIFGGFKSKDAVPKLVADFMAKKFPLEPLITHVLPFEKINEA
FDLLRAGKSIRTVLTF
NT seq 1131 nt   +upstreamnt  +downstreamnt
atgagcacagctggaaaagtaatcaaatgcaaagcggccgtgctatgggagcctcacaag
cccttcaccatcgaggacatagaagtcgcaccccccaaggcccatgaagttcgcattaag
atggtggccaccggagtctgccgctcagatgatcacgcggttagtggatccctgttcacg
cctcttcctgcagttctaggccacgagggagctggcattgttgagagcattggagaaggg
gtgacttgtgtgaaaccaggtgataaagtcatcccgctgttctctccccagtgtggaaaa
tgcaggatctgcaagcacccggaaagcaacctctgttgccaaactaagaatctgacacag
cctaagggagctttgctcgacggcaccagcaggttctcctgcaggggaaagcccattcac
cacttcatcagcaccagcaccttctcccagtacactgtggtagatgacatagcggtggcc
aaaatcgatgcggctgcaccactggacaaagtctgcctcatcggctgtggcttctcgact
ggctatggctctgccgtccaagtcgccaaggtgaccccaggctccacctgtgccgtgttt
ggcctgggaggtgttggtctgtctgtcgtcattggctgtaaaacagcaggagcagccaag
atcattgccgtggacatcaacaaagacaagtttgcgaaggccaaagagttaggtgccact
gactgtatcaaccctcaagactacaccaaacccatccaggaagttctccaggagatgact
gatggaggggtggacttttcatttgaagtcattggccgtcttgacaccatgacttctgcc
ctgttaagctgccattcagcatgcggtgtaagcgtcattgtcggggtgcctcccagtgcc
caaagcctctccgttaaccccatgtcgctgctgctgggacgcacctggaaaggagcaata
ttcggcgggtttaagagtaaagatgccgtccccaaacttgtcgctgacttcatggctaag
aagtttccgttggagccgctgattactcatgttttaccttttgaaaagataaatgaagca
tttgacctgctccgtgctggaaagagtatccgtaccgtcctgacgttctga

KEGG   Rattus norvegicus (rat): 29646
Entry
29646             CDS       T01003                                 

Gene name
Adh4
Definition
(RefSeq) all-trans-retinol dehydrogenase [NAD(+)] ADH4
  KO
K13980  alcohol dehydrogenase 4 [EC:1.1.1.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00010  Glycolysis / Gluconeogenesis
rno00071  Fatty acid degradation
rno00350  Tyrosine metabolism
rno00620  Pyruvate metabolism
rno00830  Retinol metabolism
rno00980  Metabolism of xenobiotics by cytochrome P450
rno00982  Drug metabolism - cytochrome P450
rno01100  Metabolic pathways
rno05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    29646 (Adh4)
   00620 Pyruvate metabolism
    29646 (Adh4)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    29646 (Adh4)
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    29646 (Adh4)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    29646 (Adh4)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    29646 (Adh4)
   00982 Drug metabolism - cytochrome P450
    29646 (Adh4)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    29646 (Adh4)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     29646 (Adh4)
SSDB
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 UDPG_MGDP_dh_N Glu_dehyd_C AlaDh_PNT_C
Other DBs
NCBI-GeneID: 29646
NCBI-ProteinID: NP_058966
RGD: 71028
Ensembl: ENSRNOG00000046357
UniProt: A1L128
LinkDB
Position
2
AA seq 377 aa
MGTQGKVITCKAAIAWKTDSPLCIEEIEVSPPKAHEVRIKVIATCVCPTDINATNPKKKA
LFPVVLGHECAGIVESVGPGVTNFKPGDKVIPFFAPQCKKCKLCLSPLTNLCGKLRNFKY
PTIDQELMEDRTSRFTCKGRSIYHFMGVSSFSQYTVVSEANLARVDDEANLERVCLIGCG
FTSGYGAAINTAKVTPGSACAVFGLGCVGLSAVIGCKIAGASRIIAIDINSEKFPKAKAL
GATDCLNPRDLDKPVQDVITELTGGGVDFSLDCAGTAQTLKAAVDCTVVGWGSCTVVGAK
VDEMNISTVDMILGRSVKGTFFGGWKSVDSVPNLVTDYKNKKFDLDLLVTHALPFDKIND
AIDLMNQGKSIRTILTF
NT seq 1134 nt   +upstreamnt  +downstreamnt
atgggcacccagggaaaggtcattacatgcaaggcagccattgcctggaaaactgacagc
cccctttgcattgaagaaattgaagtttctcctcctaaggctcatgaagttcgaattaag
gtaatcgccacatgcgtgtgccctactgacatcaatgccaccaatcctaagaagaaagct
ctcttcccagtagtcctcggccatgagtgtgcaggaattgtagaaagcgttgggccagga
gtgaccaacttcaaaccaggtgacaaagtaatcccattcttcgcaccacagtgcaaaaag
tgcaagctctgtctgagtcctctcacgaacctctgtgggaagctcagaaattttaaatac
cctactattgatcaagagctcatggaagacagaaccagcaggtttacctgcaaaggaaga
tcaatttaccacttcatgggagtcagttccttctctcagtacactgtggtttcagaagcc
aatcttgcccgagtggatgatgaggcaaatttggagagagtgtgtctgattggatgtggg
ttcacatcaggctatggggctgcgatcaacactgccaaggtcacccctggttccgcttgt
gctgtctttggcctggggtgtgtaggtctttctgctgtaattggatgtaaaatagcaggt
gcttccagaatcatagctattgacatcaacagtgagaagttcccaaaagccaaggccctg
ggagccactgactgccttaatcccagagacctagacaaacctgtccaagatgtcatcact
gaactgacgggtggaggtgtggatttctccctggactgtgcaggaacagctcagaccttg
aaagcagctgtagactgcaccgtcgtaggctgggggtcatgcactgtggtcggagcaaag
gttgatgaaatgaatatatccaccgtggacatgatattgggccgttctgtaaagggaacg
ttctttggtggttggaaaagtgtagactctgtcccaaacctggttactgactacaagaat
aagaaattcgatctggacttactggtgacccatgccctaccttttgacaaaatcaacgac
gcgattgacctgatgaaccaaggaaaaagcatccgaacaatcctgaccttttga

KEGG   Rattus norvegicus (rat): 310903
Entry
310903            CDS       T01003                                 

Gene name
Adh6
Definition
(RefSeq) alcohol dehydrogenase 6
  KO
K13952  alcohol dehydrogenase 6 [EC:1.1.1.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00010  Glycolysis / Gluconeogenesis
rno00071  Fatty acid degradation
rno00350  Tyrosine metabolism
rno00620  Pyruvate metabolism
rno00830  Retinol metabolism
rno00980  Metabolism of xenobiotics by cytochrome P450
rno00982  Drug metabolism - cytochrome P450
rno01100  Metabolic pathways
rno05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    310903 (Adh6)
   00620 Pyruvate metabolism
    310903 (Adh6)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    310903 (Adh6)
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    310903 (Adh6)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    310903 (Adh6)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    310903 (Adh6)
   00982 Drug metabolism - cytochrome P450
    310903 (Adh6)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    310903 (Adh6)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     310903 (Adh6)
SSDB
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 IGFBP UDPG_MGDP_dh_N 2-Hacid_dh_C
Other DBs
NCBI-GeneID: 310903
NCBI-ProteinID: NP_001012084
RGD: 1306313
Ensembl: ENSRNOG00000012436
UniProt: Q5XI95
LinkDB
Position
2
AA seq 376 aa
MGTQGKVIRCKATVLWKPGAPLAIEEIEVAPPKAKEVRIKMVATGVCGTDIKHLDTQELS
KFCPMIMGHEGVGIVESVGEGVSSVRTGDKVILLCIPQCGECKTCLNSKNNICTEIRLSK
THLASEGTSRITCKGKLVHQYIALGSFSEYTVLKEISVAKIDEGAPLEKVCIIGCGFATG
YGAAINSAKVTPGSTCAVFGLGGVGLSVIIGCKAAGAARIIAVDINKDRFAKAKTVGATD
CVDPRDFEKPIEEVLSDMIDGGVDFCFEVTGNTEAVGAALGSCHKDHGVCVTVGALASFT
STLSIRSHLFFSGRILKGSILGGWKTKEEIPKLVSDYMAKKFNIDPLITHTLTLSEANEA
VQLMKSGQCIRCVLLL
NT seq 1131 nt   +upstreamnt  +downstreamnt
atgggcacccagggaaaggtgatcagatgcaaagccactgtgctctggaagcctggagcc
ccacttgccattgaggagatcgaagtggccccacctaaagcaaaggaggttcgaataaag
atggtggccacaggagtctgtggcacagacataaaacatctggacacacaagaactttct
aagttttgccccatgattatgggccatgaaggagttgggatagtcgagagtgtgggggaa
ggagtaagcagcgtaagaacaggtgataaagttatcctattatgtatccctcagtgtggg
gaatgcaaaacttgcctgaattccaagaacaatatttgtacagaaattagactgtcaaag
acacacctggcatctgaaggcaccagcagaattacctgcaagggaaagttagtgcatcag
tatatcgctctcggcagcttctcggaatacacagtcctaaaggaaatctcagtcgccaag
attgacgaaggtgcacctctggagaaggtgtgcataattggctgtgggtttgccactggg
tacggcgctgccatcaactctgccaaggtgaccccaggctccacctgtgcggtgtttggc
ctcggaggtgtcggtctgtctgtcatcattggctgtaaagcagcaggagcagccaggatc
attgccgtggacatcaacaaagacaggtttgcgaaggccaagacagtgggtgccactgac
tgcgtcgacccacgggacttcgagaaacccattgaggaagttttatccgatatgatagat
ggtggcgtggacttctgctttgaggtcactgggaacacagaagcagtgggagctgccctg
ggctcctgtcacaaggaccacggggtctgcgtgactgttggagccctagcatctttcacc
agtacactcagcattagaagccacttgttcttctcaggacgcattctgaaagggtctatt
ttgggaggctggaaaacgaaagaagaaatccctaagctggtttctgactatatggcaaag
aagtttaacatagatcctctgatcacccacaccctgactctcagcgaggccaatgaggca
gttcagctcatgaaaagtgggcaatgtatccgctgtgtcctgctcctataa

DBGET integrated database retrieval system