KEGG   Rattus norvegicus (rat): 100270683
Entry
100270683         CDS       T01003                                 
Symbol
Tas1r2
Name
(RefSeq) taste receptor type 1 member 2 precursor
  KO
K04625  taste receptor type 1 member 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04742  Taste transduction
rno04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100270683 (Tas1r2)
  09157 Sensory system
   04742 Taste transduction
    100270683 (Tas1r2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    100270683 (Tas1r2)
G protein-coupled receptors [BR:rno04030]
 Others
  Chemoreception
   Taste
    100270683 (Tas1r2)
SSDB
Motif
Pfam: ANF_receptor 7tm_3 NCD3G CCER1
Other DBs
NCBI-GeneID: 100270683
NCBI-ProteinID: NP_001258195
Ensembl: ENSRNOG00000061876
UniProt: Q9Z0R7
LinkDB
Position
5:151909648..151925345
AA seq 843 aa
MGPQARTLCLLSLLLHVLPKPGKLVENSDFHLAGDYLLGGLFTLHANVKSISHLSYLQVP
KCNEFTMKVLGYNLMQAMRFAVEEINNCSSLLPGVLLGYEMVDVCYLSNNIHPGLYFLAQ
DDDLLPILKDYSQYMPHVVAVIGPDNSESAITVSNILSHFLIPQITYSAISDKLRDKRHF
PSMLRTVPSATHHIEAMVQLMVHFQWNWIVVLVSDDDYGRENSHLLSQRLTKTSDICIAF
QEVLPIPESSQVMRSEEQRQLDNILDKLRRTSARVVVVFSPELSLYSFFHEVLRWNFTGF
VWIASESWAIDPVLHNLTELRHTGTFLGVTIQRVSIPGFSQFRVRRDKPGYPVPNTTNLR
TTCNQDCDACLNTTKSFNNILILSGERVVYSVYSAVYAVAHALHRLLGCNRVRCTKQKVY
PWQLLREIWHVNFTLLGNRLFFDQQGDMPMLLDIIQWQWDLSQNPFQSIASYSPTSKRLT
YINNVSWYTPNNTVPVSMCSKSCQPGQMKKSVGLHPCCFECLDCMPGTYLNRSADEFNCL
SCPGSMWSYKNDITCFQRRPTFLEWHEVPTIVVAILAALGFFSTLAILFIFWRHFQTPMV
RSAGGPMCFLMLVPLLLAFGMVPVYVGPPTVFSCFCRQAFFTVCFSICLSCITVRSFQIV
CVFKMARRLPSAYSFWMRYHGPYVFVAFITAIKVALVVGNMLATTINPIGRTDPDDPNIM
ILSCHPNYRNGLLFNTSMDLLLSVLGFSFAYMGKELPTNYNEAKFITLSMTFSFTSSISL
CTFMSVHDGVLVTIMDLLVTVLNFLAIGLGYFGPKCYMILFYPERNTSAYFNSMIQGYTM
RKS
NT seq 2532 nt   +upstreamnt  +downstreamnt
atgggtccccaggcaaggacactctgcttgctgtctctcctgctgcatgttctgcctaag
ccaggcaagctggtagagaactctgacttccacctggccggggactacctcctgggtggc
ctctttaccctccatgccaacgtgaagagcatctcccacctcagctacctgcaggtgccc
aagtgcaatgagttcaccatgaaggtgttgggctacaacctcatgcaggccatgcgtttc
gctgtggaggagatcaacaactgtagctccctgctacccggcgtgctgctcggctacgag
atggtggatgtctgttacctctccaacaatatccaccctgggctctacttcctggcacag
gacgacgacctcctgcccatcctcaaagactacagccagtacatgccccacgtggtggct
gtcattggccccgacaactctgagtccgccattaccgtgtccaacattctctctcatttc
ctcatcccacagatcacatacagcgccatctccgacaagctgcgggacaagcggcacttc
cctagcatgctacgcacagtgcccagcgccacccaccacatcgaggccatggtgcagctg
atggttcacttccaatggaactggattgtggtgctggtgagcgacgacgattacggccgc
gagaacagccacctgttgagccagcgtctgaccaaaacgagcgacatctgcattgccttc
caggaggttctgcccatacctgagtccagccaggtcatgaggtccgaggagcagagacaa
ctggacaacatcctggacaagctgcggcggacctcggcgcgcgtcgtggtggtgttctcg
cccgagctgagcctgtatagcttctttcacgaggtgctccgctggaacttcacgggtttt
gtgtggatcgcctctgagtcctgggctatcgacccagttctgcataacctcacggagctg
cgccacacgggtacttttctgggcgtcaccatccagagggtgtccatccctggcttcagt
cagttccgagtgcgccgtgacaagccagggtatcccgtgcctaacacgaccaacctgcgg
acgacctgcaaccaggactgtgacgcctgcttgaacaccaccaagtccttcaacaacatc
cttatactttcgggggagcgcgtggtctacagcgtgtactcagcagtttacgcggtggcc
catgccctccacagactcctcggctgtaaccgggtccgctgcaccaagcaaaaggtctac
ccgtggcagctactcagggagatctggcacgtcaacttcacgctcctgggtaaccggctc
ttctttgaccaacaaggggacatgccgatgctcttggacatcatccagtggcagtgggac
ctgagccagaatcccttccaaagcatcgcctcctattctcccaccagcaagaggctaacc
tacattaacaatgtgtcctggtacacccccaacaacacggtccctgtctccatgtgttcc
aagagctgccagccagggcaaatgaaaaagtctgtgggcctccacccttgttgcttcgag
tgcttggattgtatgccaggcacctacctcaaccgctcagcagatgagtttaactgtctg
tcctgcccgggttccatgtggtcctacaagaacgacatcacttgcttccagcggcggcct
accttcctggagtggcacgaagtgcccaccatcgtggtggccatactggctgccctgggc
ttcttcagtacactggccattcttttcatcttctggagacatttccagacacccatggtg
cgctcggccggtggccccatgtgcttcctgatgctcgtgcccctgctgctggcgtttggg
atggtgcccgtgtatgtggggccccccacggtcttctcatgcttctgccgacaggctttc
ttcaccgtctgcttctccatctgcctatcctgcatcaccgtgcgctccttccagatcgtg
tgtgtcttcaagatggccagacgcctgccaagtgcctacagtttttggatgcgttaccac
gggccctatgtcttcgtggccttcatcacggccatcaaggtggccctggtggtgggcaac
atgctggccaccaccatcaaccccattggccggaccgacccggatgaccccaacatcatg
atcctctcgtgccaccctaactaccgcaacgggctactgttcaacaccagcatggacttg
ctgctgtctgtgctgggtttcagcttcgcttacatgggcaaggagctgcccaccaactac
aacgaagccaagttcatcactctcagcatgaccttctccttcacctcctccatctccctc
tgcaccttcatgtctgtgcacgacggcgtgctggtcaccatcatggacctcctggtcact
gtgctcaacttcctggccatcggcttgggatactttggccccaagtgttacatgatcctt
ttctacccggagcgcaacacctcagcctatttcaatagcatgatccagggctacaccatg
aggaagagctag

DBGET integrated database retrieval system