KEGG   Rattus norvegicus (rat): 100361574
Entry
100361574         CDS       T01003                                 
Symbol
Polr2k
Name
(RefSeq) DNA-directed RNA polymerases I, II, and III subunit RPABC4
  KO
K03009  DNA-directed RNA polymerases I, II, and III subunit RPABC4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03020  RNA polymerase
rno04623  Cytosolic DNA-sensing pathway
rno05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    100361574 (Polr2k)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    100361574 (Polr2k)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    100361574 (Polr2k)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:rno03021]
    100361574 (Polr2k)
   03400 DNA repair and recombination proteins [BR:rno03400]
    100361574 (Polr2k)
Transcription machinery [BR:rno03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Pol I, II, III common subunits
     100361574 (Polr2k)
  RNA polymerase III system
   RNA polymerase III
     100361574 (Polr2k)
  RNA polymerase I system
   RNA polymerase I
     100361574 (Polr2k)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      100361574 (Polr2k)
SSDB
Motif
Pfam: DNA_RNApol_7kD A2L_zn_ribbon Cytochrome_C7 DUF5816 MCM_OB HypA DZR zinc_ribbon_13
Other DBs
NCBI-GeneID: 100361574
NCBI-ProteinID: NP_001269254
RGD: 2319895
Ensembl: ENSRNOG00000010408
UniProt: F1LZN9
LinkDB
Position
7:67347118..67359466
AA seq 58 aa
MDTQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKRLVVFDAR
NT seq 177 nt   +upstreamnt  +downstreamnt
atggacacccagaaagatgttcaaccaccaaagcagcagccaatgatatatatttgtgga
gagtgtcacaccgaaaatgaaataaaatccagggatccaatcagatgcagagaatgtgga
tacagaataatgtacaagaaaaggactaagagattggtggtttttgatgctcgatga

KEGG   Rattus norvegicus (rat): 300088
Entry
300088            CDS       T01003                                 
Symbol
Polr3h
Name
(RefSeq) DNA-directed RNA polymerase III subunit RPC8
  KO
K03022  DNA-directed RNA polymerase III subunit RPC8
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03020  RNA polymerase
rno04623  Cytosolic DNA-sensing pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    300088 (Polr3h)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    300088 (Polr3h)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:rno03021]
    300088 (Polr3h)
Transcription machinery [BR:rno03021]
 Eukaryotic type
  RNA polymerase III system
   RNA polymerase III
    Pol III specific subunits
     300088 (Polr3h)
SSDB
Motif
Pfam: RNA_pol_Rbc25 SHS2_Rpb7-N
Other DBs
NCBI-GeneID: 300088
NCBI-ProteinID: NP_001120767
RGD: 1305889
Ensembl: ENSRNOG00000004471
UniProt: B2RZB0
LinkDB
Position
7:complement(113429434..113439743)
AA seq 204 aa
MFVLVEMVDTVRIPPWQFERKLNDSIAEELNKKLANKVVYNVGLCICLFDITKLEDAYVF
PGDGASHTKVHFRYVVFHPFLDEILIGKIKGCSPEGVHVSLGFFDDILIPPESLQQPAKF
DEAEQVWVWEYETEEGAHDLYMDTGEEIRFRVVDESFVDTSPTGPSSAEAASSSEELPKK
EAPYTLVGSISEPGLGLLSWWTSN
NT seq 615 nt   +upstreamnt  +downstreamnt
atgttcgtgctggtggagatggtggacaccgtgcgcatacccccgtggcagtttgagcgg
aaactcaacgactccattgctgaggagctgaacaagaaattggccaacaaggtcgtatac
aatgtgggactctgcatctgtctgtttgatatcaccaagctggaggatgcctacgtattc
ccaggggatggagcatcacataccaaagtgcatttccgatacgtggtgttccaccctttc
ctggatgagattctcattgggaagatcaaaggctgcagcccagagggtgtgcacgtctct
ttagggttctttgatgacatcctcatcccccctgagtcactgcagcagcctgccaagttt
gatgaagcggagcaagtgtgggtgtgggagtatgagaccgaggaaggagctcatgacctg
tacatggacactggtgaggagatccgcttcagggtggtggatgagagttttgtggacaca
tcccccacaggacccagctcagccgaggctgcctcttcaagcgaggagctgccaaagaag
gaagcaccatatacactcgtgggatccatcagtgagccaggcctgggccttctctcctgg
tggaccagcaactag

KEGG   Rattus norvegicus (rat): 301246
Entry
301246            CDS       T01003                                 
Symbol
Polr1c
Name
(RefSeq) DNA-directed RNA polymerases I and III subunit RPAC1
  KO
K03027  DNA-directed RNA polymerases I and III subunit RPAC1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03020  RNA polymerase
rno04623  Cytosolic DNA-sensing pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    301246 (Polr1c)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    301246 (Polr1c)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:rno03021]
    301246 (Polr1c)
Transcription machinery [BR:rno03021]
 Eukaryotic type
  RNA polymerase III system
   RNA polymerase III
    Core subunits
     301246 (Polr1c)
  RNA polymerase I system
   RNA polymerase I
     301246 (Polr1c)
SSDB
Motif
Pfam: RNA_pol_A_bac RNA_pol_L
Other DBs
NCBI-GeneID: 301246
NCBI-ProteinID: NP_001008331
RGD: 1309689
Ensembl: ENSRNOG00000019079
UniProt: Q5RJK9
LinkDB
Position
9:14735740..14739852
AA seq 346 aa
MAAAQAVEEMRTRVVLGEFGVRNVHTTDFPGNYSGYDDAWDQDRFEKNFRVDVVHMDEST
LEFDMVGIDAAIANAFRRILLAEVPTMAVEKVLVYNNTSIVQDEILAHRLGLIPILADPR
LFEYRNPGEEEGTEIDTLQFRLQVRCTRNPSAAKDSSDPNELYVNHKVYTRHMTWVPLGN
QADVFPEGTVRPVHDDILIAQLRPGQEIDLMMHCVKGIGKDHAKFSPVATASYRLLPDIT
LLEPVEGEAAEELSQCFSPGVIAVQEVQGKKVARVANARLDTFSREIFRHEKLKKAVRLA
RVRDHYIFSVESTGVLPPDVLVSEAIKILMGKCRRFLDELDAVEMD
NT seq 1041 nt   +upstreamnt  +downstreamnt
atggcggctgctcaggcggtggaggaaatgcggactcgcgtggttctgggagagtttggg
gttcgcaatgtccacaccactgactttcccggtaactactccggttatgatgatgcctgg
gaccaggaccggttcgagaagaacttccgtgtggacgtggtgcatatggacgagagcaca
ctggagttcgacatggtggggattgatgctgccattgccaatgccttccggaggattctg
ttagctgaggtgccaacaatggctgtggaaaaggttttggtgtataacaacacatccatc
gtccaggatgagatccttgctcaccgcctggggcttatccccattcttgctgatccacgt
ctctttgaatatcggaacccaggagaggaggagggaacagagatagatacactacagttt
cggctgcaggtcaggtgtaccaggaaccccagtgctgctaaggattcttccgaccccaat
gaactctatgtgaaccacaaagtttataccaggcacatgacgtgggtgcccttgggaaac
caggctgatgtcttcccggagggcacggttcgccctgtgcatgacgacatcctcattgcc
cagcttcggcccggccaggagattgacctgatgatgcactgcgtcaagggcatcggcaaa
gaccatgccaagttctcaccggtggccacagccagctacaggctcctgccggacatcacc
ctgcttgaacctgtagaaggggaagcagccgaggagctgagccagtgcttctcacccggc
gtgattgcggtgcaggaagtacaaggtaaaaaggtggccagggttgccaatgctcggctg
gataccttcagcagggagatcttccgtcatgagaagctcaagaaggccgtgcggcttgcc
cgtgttcgggaccattacatcttttctgtggagtcaactggggttttgccaccagatgtg
ttggtgagtgaagctatcaagatcctgatggggaagtgccggcggttcttggatgaacta
gatgcagttgagatggactga

KEGG   Rattus norvegicus (rat): 306012
Entry
306012            CDS       T01003                                 
Symbol
Polr3d
Name
(RefSeq) DNA-directed RNA polymerase III subunit RPC4
  KO
K03026  DNA-directed RNA polymerase III subunit RPC4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03020  RNA polymerase
rno04623  Cytosolic DNA-sensing pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    306012 (Polr3d)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    306012 (Polr3d)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:rno03021]
    306012 (Polr3d)
Transcription machinery [BR:rno03021]
 Eukaryotic type
  RNA polymerase III system
   RNA polymerase III
    Pol III specific subunits
     306012 (Polr3d)
SSDB
Motif
Pfam: RNA_pol_Rpc4
Other DBs
NCBI-GeneID: 306012
NCBI-ProteinID: NP_001026823
RGD: 1311816
Ensembl: ENSRNOG00000010028
UniProt: Q4FZS9
LinkDB
Position
15:complement(45511587..45516256)
AA seq 398 aa
MSEGNAAGEPSNPGGPRPLLSGGRGLVGRRPAPPLTPGRLPSIRSRDLTLGGVKKKTFTP
NIISRKIKEEPKEEVTMKKEKRERDRDRQREGHGRGRGRPEVIQSHSIFEQGPAEMMKKK
GNWDKTVDMSDMGPSHIINIKKEKRETDEETKQILRMLEKDDFIDDPGLKNDTRNMPVQL
PLAHSGWLFKEESEEPDVKPFSAGPKEEDMEVDVPAVKVKEEPRDEEEEAKVKAPPRAAR
KTPGLPKDVSVAELLRELSLTKEEELLFLQLPDTLPGQPPTQDIKPVKTEVQGEDGQMVV
IKQEKDRETRLAENACTLADLTEGQVGKLLIRKSGKVQLLLGKVTLDVTMGTTCSFLQEL
VSVGLGDSRTGEMTVLGHVKHKLVCSPDFESLLDHKHR
NT seq 1197 nt   +upstreamnt  +downstreamnt
atgtcggaaggaaacgccgcgggcgagcccagcaatcctggagggccccgaccccttctc
tctgggggccggggacttgtgggccggcggcccgctcccccgcttacgccaggccgcctt
ccctccatccgctctcgggacctcacccttggcggtgtcaagaagaaaaccttcacccca
aatatcatcagtcggaagatcaaagaagagccaaaggaagaagtaactatgaagaaggaa
aagcgtgaacgggacagagaccgccagcgtgagggtcatggacggggacgtggccgccca
gaagtgatccagtcccattccatctttgagcagggtccagcagaaatgatgaaaaaaaaa
gggaactgggataagactgtggatatgtcagacatggggccttctcatatcatcaacatc
aaaaaagagaagagagaaacagatgaagaaaccaagcagatcttgcgcatgctggagaag
gatgatttcatcgatgacccagggctaaagaatgacacacggaacatgccagtacaactg
ccactggctcattcagggtggcttttcaaggaggagagtgaagagccagacgttaagcct
ttttctgctggccccaaggaagaagacatggaggtggatgtgccagctgtaaaagtgaaa
gaggagccacgggatgaggaagaggaggcgaaagtgaaagcccctccaagagcagccagg
aagacccctggtcttccaaaggacgtgtctgtggcagagctgctgagggagttgagcctc
acgaaggaggaggagctgctgttccttcagctgcctgataccctccctgggcagccgcct
actcaggacatcaagcctgtcaagacagaggtgcagggcgaggatggacagatggtagtc
ataaagcaagaaaaggaccgggaaaccaggctagcagagaatgcttgtaccttggctgac
ctgacagagggtcaagtgggcaagctactcatccgcaaatcagggaaggtgcagcttctc
ctgggcaaggtgactctggatgtgaccatgggaacaacctgttctttcctgcaggaactg
gtgtctgtgggccttggggacagcaggacaggggagatgacagtcctaggacatgtgaag
cacaaacttgtatgttctcctgattttgaatctctcttggatcacaaacaccggtga

KEGG   Rattus norvegicus (rat): 310685
Entry
310685            CDS       T01003                                 
Symbol
Polr3c
Name
(RefSeq) DNA-directed RNA polymerase III subunit RPC3
  KO
K03023  DNA-directed RNA polymerase III subunit RPC3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03020  RNA polymerase
rno04623  Cytosolic DNA-sensing pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    310685 (Polr3c)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    310685 (Polr3c)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:rno03021]
    310685 (Polr3c)
Transcription machinery [BR:rno03021]
 Eukaryotic type
  RNA polymerase III system
   RNA polymerase III
    Pol III specific subunits
     310685 (Polr3c)
SSDB
Motif
Pfam: RNA_pol_Rpc82 HTH_9 TFIIE_alpha
Other DBs
NCBI-GeneID: 310685
NCBI-ProteinID: NP_001012081
RGD: 1311545
Ensembl: ENSRNOG00000033560
UniProt: Q5XIL3
LinkDB
Position
2:complement(184246201..184262150)
AA seq 533 aa
MTQAEIKLCSLLLQEHFGEIVEKIGVHLIRTGSQPLRVIAHDTKASLDQVKKALCVLIHH
NLVIYHVHKRGVVEYEAQCSRVLRMLRYPRYIYTTKTLYGDTGELIVEELLLNGKMTMSA
VVKKVADRLTETMEDGKTMDYAEVSNAFVRLADTHFVQRCPLVPDTDSSDPGPPPPAPNL
VINEKDMYLVPKLSLIGKGKRRRSSDEDAAGEPKAKKPRCTDNEEPTPDDGIYWQVNLDR
FHQHFRDQAIVSAVANRMDQTSSEIVRTMLRMSEITTPSGAPFTQPLSSNEIFRSLPVGY
NISKQVLDQYLTLLADDPLEFIGKAGDSGGGMYVINLHKALASLSTATLESVIQERFGSR
CARIFRLVLQKKHLEQKQVEDFAMIPAKEAKDMLYKMLSENFISLQEIPKTPDHAPSRTF
YLYTVNVLSAARMLLHRCYKSIANLIERRQFETKENKRLLEKSQRVEAIMASMQATGAEE
VQLQEIEEMITAPERQQLETLKRNVNKLDASEIQVDETIFLLESYIESTMKRQ
NT seq 1602 nt   +upstreamnt  +downstreamnt
atgactcaagcagaaattaaactgtgctctttgttgctacaagagcattttggtgagatt
gtagaaaaaattggagtccacctaatcagaactgggagccagccacttagagtaattgcc
catgacacaaaagcatcactggaccaggtgaaaaaagccctttgtgtcctcattcaccat
aacctggtcatctatcatgtgcataaacgcggtgtggtggagtatgaagcccaatgcagc
cgggtactgcggatgcttcggtacccccggtacatctatactaccaaaacactgtatggt
gacactggagagctgattgttgaggagcttctgctgaatggcaaaatgacaatgtcggct
gttgtgaagaaagtagcagaccgactcacagagaccatggaggatggcaagaccatggac
tacgctgaggtgtcaaatgcatttgttcgactggcagatactcactttgtacagcgctgt
cccctggttcctgacactgacagttctgaccccgggccgccgccacctgccccaaacctt
gtcattaatgaaaaggacatgtacctagttcccaaactgagcttgataggaaaaggtaag
aggaggagatcatctgacgaagatgctgctggagagcccaaggccaagaaaccaagatgc
acagataatgaggagcccacaccagacgatgggatttattggcaagtcaacctggacaga
ttccaccagcacttccgtgaccaagcaattgtgagcgcagtggcaaaccgaatggaccag
acaagcagcgagattgtgcggacaatgctccgaatgagtgagattaccactccctctggt
gcgccgtttactcagccactgtcctccaatgagatcttcagatccctgcccgtcggatat
aatatctctaaacaggttctggatcagtacctcacgctgctggcagatgacccactagaa
tttattggaaaggctggcgacagtggcggaggaatgtatgtcatcaacctccataaggca
ttagcatccctatccactgcaactctggagtctgtcatccaagagagattcgggtctcgc
tgtgcccggatattccgtctggtgttgcagaagaagcacctggagcagaagcaggtggag
gactttgcaatgatccctgcaaaggaggcaaaggacatgctgtataagatgctctcggag
aacttcatatcactgcaggaaattcctaaaacgccagaccacgccccgtccaggaccttc
tatctgtacaccgtgaatgtgctgtcagccgccaggatgctgttgcacaggtgctacaag
agcatagccaacttgatagaaaggcggcaatttgaaacaaaagagaacaagcggctacta
gaaaagtctcagcgggtggaagccatcatggcatcaatgcaggccacgggtgcagaggag
gtacagctgcaggagatcgaggagatgatcacagcccccgagcggcagcagctggagaca
ctgaaacgcaacgttaacaagttggatgccagtgagatccaggtagatgaaaccatcttc
ttactggaatcatacatcgagagcaccatgaagagacagtga

KEGG   Rattus norvegicus (rat): 311487
Entry
311487            CDS       T01003                                 
Symbol
Polr3f
Name
(RefSeq) DNA-directed RNA polymerase III subunit RPC6
  KO
K03025  DNA-directed RNA polymerase III subunit RPC6
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03020  RNA polymerase
rno04623  Cytosolic DNA-sensing pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    311487 (Polr3f)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    311487 (Polr3f)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:rno03021]
    311487 (Polr3f)
Transcription machinery [BR:rno03021]
 Eukaryotic type
  RNA polymerase III system
   RNA polymerase III
    Pol III specific subunits
     311487 (Polr3f)
SSDB
Motif
Pfam: RNA_pol_Rpc34 TrmB CDC24_OB1 TFIIE_alpha
Other DBs
NCBI-GeneID: 311487
NCBI-ProteinID: NP_001101254
RGD: 1306428
Ensembl: ENSRNOG00000007548
UniProt: D3ZQ56
LinkDB
Position
3:131908466..131924838
AA seq 371 aa
MGAPSRPHEEGPARPKEEGPSSLPRPHPWRAPPPVPENSSALLRATFPLVLKTTLMAEVK
VKVQPPDADPVEIENRIIELCHQFPHGITDQVIQNEMPHIEAQQRAVAINRLLSMGQLDL
LRSNTGLLYRIKDSQNAGKMKGSDNQEKLVYQIIEDAGNKGIWSRDIRYKSNLPLTEINK
ILKNLESKKLIKAVKSVAASKKKVYMLYNLQPDRSVTGGAWYSDQDFESEFVEVLNQQCF
KFLQSKAETARESKQNPVIQRNSSFASSHEVWKYICELGISKVELSMEDIETILNTLIYD
GKVDMTIIAAKEGTVGSVDGHMKLYRAVNPILPPTGLVRAPCGLCPVFDDCHEGGEISPS
NCIYMTEWLEF
NT seq 1116 nt   +upstreamnt  +downstreamnt
atgggcgccccaagccgacctcatgaagaaggcccggcgcgaccgaaggaagaaggtccc
tcgtccctcccacgcccccacccctggcgtgcgcctccaccggttcccgagaattccagc
gcgctcctccgggccacttttcctctagtcttgaaaaccaccctcatggcggaggtgaag
gtgaaggtgcagccgccggacgcggatccggtggaaatagaaaacagaattatagaatta
tgccaccagttccctcatggaatcacagatcaagtaattcagaatgaaatgcctcacata
gaagcccagcaacgggcagtggccatcaatagactattgtccatgggtcagttggatctt
ttacggagtaatacaggccttttatatagaataaaggattctcagaatgctggtaaaatg
aaggggtccgataaccaggaaaagctagtctaccaaatcatagaggatgcagggaataaa
ggaatatggagcagagatattcggtacaaaagcaacttgccattaacagaaatcaacaaa
attctcaagaatttggaaagtaaaaagcttattaaagctgtgaagtctgtagcagcttcc
aaaaagaaggtttacatgctctataacctgcagccagaccggtctgtgactggcggggcc
tggtacagtgaccaggattttgaatctgaatttgttgaggtgcttaatcaacagtgtttc
aaattcctacagagcaaggcagagactgcaagagaaagtaaacagaatccagtgatacaa
agaaacagttcatttgcttcatcacatgaagtgtggaagtacatctgtgaactgggcatc
agtaaggtagagttgtccatggaggacattgaaaccatcttgaacacactcatttatgat
ggcaaagtggatatgactatcattgctgccaaggaaggcactgttgggagcgttgatgga
cacatgaaactgtacagggcagtcaacccaatcctcccacctacaggcttggtccgggca
ccctgtggactctgtcccgtttttgatgactgccatgaaggtggtgaaatttcaccatct
aattgtatttacatgacagagtggctcgaattttaa

KEGG   Rattus norvegicus (rat): 361102
Entry
361102            CDS       T01003                                 
Symbol
Polr3a
Name
(RefSeq) DNA-directed RNA polymerase III subunit RPC1
  KO
K03018  DNA-directed RNA polymerase III subunit RPC1 [EC:2.7.7.6]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03020  RNA polymerase
rno04623  Cytosolic DNA-sensing pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    361102 (Polr3a)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    361102 (Polr3a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:rno03021]
    361102 (Polr3a)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.6  DNA-directed RNA polymerase
     361102 (Polr3a)
Transcription machinery [BR:rno03021]
 Eukaryotic type
  RNA polymerase III system
   RNA polymerase III
    Core subunits
     361102 (Polr3a)
SSDB
Motif
Pfam: RNA_pol_Rpb1_1 RNA_pol_Rpb1_5 RNA_pol_Rpb1_2 RNA_pol_Rpb1_3 RNA_pol_Rpb1_4
Other DBs
NCBI-GeneID: 361102
NCBI-ProteinID: XP_341389
RGD: 1305574
Ensembl: ENSRNOG00000010008
UniProt: E9PTB6
LinkDB
Position
16:complement(49178..88178)
AA seq 1390 aa
MVKEQFRETDVAKKISHICFGMKSPEEMRQQAHIQVVSKNLYSQDNNHAPLLYGVLDHRM
GTSEKDRPCETCGKNLADCLGHYGYIDLELPCFHVGYFRAVIGILQMICKTCCHIMLSQE
EKQQFLDFLKRPGLTYLQKRGLKKKISDKCRKKSTCHYCGAFNGTVKKCGLLKIIHEKYK
TNKKVVDPIVSNFLQSFETAIEHNKEVEPLLGRAQENLNPLVVLNLFKRIPAEDVPLLLM
NPEAGKPSDLILTRLLVPPLCIRPSVVSDLKSGTNEDDLTMKLTEIIFLNDVIKKHRISG
AKTQMIMEDWDFLQLQCALYINSELSGIPLNMAPKKWTRGFVQRLKGKQGRFRGNLSGKR
VDFSGRTVISPDPNLRIDEVAVPVHVAKILTFPEKVNKANINFLRKLVRNGPDVHPGANF
IQQRHMQMKRFLKYGNREKMAQELKFGDIVERHLIDGDVVLFNRQPSLHKLSIMAHLAKV
KPHRTFRFNECVCTPYNADFDGDEMNLHLPQTEEAKAEALVLMGTKANLVTPRNGEPLIA
AIQDFLTGAYLLTLKDTFFDRAKACQIIASILVGKDEKIKVRLPPPTILKPVTLWTGKQI
FSVILRPSDDNPVRANLRTKGKQYCGKGEDLCTNDSYVTIQNSELMCGSMDKGTLGSGSK
NNIFYILLRDWGQNEAADAMSRLARLAPVYLSNRGFSIGIGDVTPGQGLLKAKYELLNAG
YKKCDEYIEALNTGKLQQQPGCTAEETLEALILKELSVIRDHAGSACLRELDKSNSPLTM
ALCGSKGSFINISQMIACVGQQAISGSRVPDGFENRSLPHFEKHSKLPAAKGFVANSFYS
GLTPTEFFFHTMAGREGLVDTAVKTAETGYMQRRLVKSLEDLCSQYDLTVRSSTGDIIQF
IYGGDGLDPAAMEGKDEPLEFKRVLDNIKAVYPCQSERALSKNELTLTTEAIMKKNEFLC
CQDSFLQEIKTFIKGVSEKIKKTRDKYGINDNGTTEPRVLYQLDRITRTQIEKFLETCRD
KYMRAQMEPGSAVGALCAQSIGEPGTQMTLKTFHFAGVASMNITLGVPRIKEIINASKAI
STPIITAQLDMDDDADYARLVKGRIEKTLLGEISEYIEEVFLPDDCFILVKLSLERIRLL
RLEVNAETVRYSICTSKLRVKPGDVAVHGEAVVCVTPRENSKSSMYYVLQFLKEDLPKVV
VQGIPEVSRAVIHIDEQSGKEKFKLLVEGDNLRAVMATHGVKGTRTTSNNTYEVEKTLGI
EAARTTIINEIQYTMVNHGMSIDRRHVMLLSDLMTYKGEVLGITRFGLAKMKESVLMLAS
FEKTADHLFDAAYFGQKDSVCGVSECIIMGIPMNIGTGLFKLLHKANRDPKPPRRPLIFD
THEFHIPLVT
NT seq 4173 nt   +upstreamnt  +downstreamnt
atggtgaaggagcagttccgcgagacggatgtggctaagaaaataagccatatctgtttt
ggaatgaagtcccctgaggagatgcgccagcaggcacatatccaggttgtcagtaagaac
ctgtacagccaagacaacaaccatgcccccttgttgtatggagtgcttgaccatagaatg
gggacaagtgaaaaggatcgtccttgtgagacctgtgggaagaacctggcagactgtctg
ggccactatgggtacattgatctagagctgccgtgctttcatgtcgggtacttcagagct
gtcattggcattttacagatgatctgcaaaacctgctgccacattatgctgtcccaggaa
gagaagcagcagtttctagatttcctgaagaggcctggcctaacctacctgcagaagcga
ggcctgaagaagaagatctcagacaagtgccggaagaaaagcacttgtcactactgtggt
gcttttaatggtactgtaaagaaatgtggtttgctgaagataattcatgaaaaatacaag
acaaacaaaaaagttgtggatcccattgtatcaaacttcctgcagtcttttgagacagcc
attgagcataacaaagaggttgaaccactgctaggaagggcccaggagaacttgaatccc
ttagtagttctgaacttgtttaagcgcatcccagctgaagatgtcccgttacttctgatg
aacccagaagctggaaagccctctgatttgattctcacccgacttttggtgcctcccctg
tgtatcagaccttctgtcgtgagtgatttgaagtctggaaccaatgaagatgatctgaca
atgaaactgaccgagatcattttcctaaatgatgttattaaaaagcaccgcatctctgga
gccaagacacagatgatcatggaggactgggatttcctgcagctacagtgtgccctctat
atcaacagtgagctctctggcatccctctcaacatggcacctaagaagtggactcgaggc
tttgtccagcgtctgaaggggaagcagggtcgatttagaggtaatctgtcagggaagagg
gtggatttttctggccgaacagtcatctcacctgaccccaacctccgcattgatgaagta
gctgtgccagttcatgtggccaaaattctaacttttcctgagaaggtgaacaaagcaaac
atcaattttttgaggaaactggttcgaaatggcccagatgttcacccaggagccaatttt
atccaacagaggcacatgcagatgaaaaggttcctgaagtatgggaatcgggaaaagatg
gctcaggagctcaagttcggtgacattgtagagagacacctgatagatggagacgtggta
ttgttcaaccggcagccctcactgcacaaactgagcatcatggcccatctggccaaggtc
aagcctcatcgaaccttcagattcaatgaatgtgtctgcactccctacaatgcagacttc
gatggggatgaaatgaaccttcatcttccccagacagaggaagccaaagcagaggccctt
gttctcatggggaccaaagcgaaccttgtaaccccaagaaatggggagccactcattgct
gccattcaggacttcctaacaggtgcctacctcctcaccctcaaggacactttctttgat
cgagccaaggcttgccagatcattgcttcaatactggttggcaaagatgaaaaaattaaa
gtgcgcctcccaccccctacaatactaaagcctgtcaccctgtggaccggaaagcaaatc
ttcagtgtcatcctcaggcctagtgacgacaatccagtgagggccaaccttcgaaccaag
ggcaagcagtactgtggcaagggggaagacctctgcaccaacgattcctatgtcaccatc
cagaacagcgagttgatgtgcggcagcatggacaaagggactctggggtcggggtccaag
aacaacatcttctacatcttgcttcgagactgggggcagaacgaggctgccgatgccatg
tctcggcttgccaggctggctcctgtctacctgtctaaccgtgggttctccattgggatt
ggtgacgtcacgcctggccagggactgctgaaagccaagtatgagctactaaatgctggc
tacaaaaaatgtgacgaatacattgaagccctgaacacaggcaagctgcagcagcagcca
ggctgcactgctgaggagacactagaggctctgatcctgaaggagctgtctgtgatccgg
gaccatgctggcagtgcctgcctccgagagctggacaagagcaacagccctctcaccatg
gccctgtgtggttccaaaggttccttcattaacatatcacagatgattgcctgtgtggga
cagcaagccatcagtggctcccgtgttccagatggctttgagaacagatctttgcctcac
tttgagaagcattcaaagctccctgctgccaaaggctttgtggctaacagcttttactct
ggcttaacgcctactgaatttttcttccacacaatggctggtcgggagggtctggtggac
acagctgtaaagactgctgaaacaggatacatgcagagaagactggtcaaatccctggaa
gacctctgttcccagtatgatctgaccgttcggagttccaccggtgacatcatccagttc
atctatggaggggatggcttagatcctgccgccatggagggcaaagatgaaccactggag
tttaaaagagttctggacaacatcaaggcagtgtatccatgtcagagtgaacgtgctctc
agtaagaatgagctcaccttgaccactgaggccatcatgaagaagaacgagttcctgtgc
tgccaagacagcttcctgcaggaaataaaaacattcattaaaggggtgtctgagaagatt
aagaaaaccagagataaatacggcatcaatgacaacggcacaacagagcctcgtgtgctg
taccagttggaccgtattacccgtacccaaatagagaagtttctggagacctgtagggat
aagtacatgagggcacagatggagccaggctctgcagtgggtgcactctgtgcacagagc
attggtgagccgggcacccagatgaccctgaagactttccactttgcaggggtagcgtcc
atgaacatcaccctgggtgtgcctcggatcaaggagatcatcaatgcttccaaggccatc
agcactccaattatcacagcacagctagacatggatgacgatgcagattatgcacgcctg
gtgaagggcaggattgagaaaaccctcctgggggagatctcagagtacattgaagaagtg
tttcttcctgatgactgctttattcttgtcaagctgtccctggaacggatccgacttctg
agactggaggttaatgctgagacagtgcgctactccatctgcacatccaagctccgagtg
aagcctggcgatgtggcggttcatggggaggccgtggtgtgtgtcacccccagggaaaac
agcaagagctccatgtattatgtgctgcagtttctaaaagaggatctacccaaggtggtg
gtacagggcatcccagaggtgtcaagagcagtcatccacattgacgagcagagtgggaag
gagaagttcaagcttctagtagaaggtgacaacctgcgggcagtcatggccacccatggt
gtgaaaggcacgcgaaccacttctaataacacctatgaggtggaaaaaaccctgggtatt
gaggctgcgaggacaaccatcatcaatgagatccagtacacgatggtcaaccatggcatg
agcattgacaggaggcacgtgatgctgctctctgatctgatgacctacaagggtgaagta
ctgggtataaccaggtttggcctggccaagatgaaggagagtgtgttgatgctggcctcc
tttgagaagacagctgaccatctctttgatgctgcctactttgggcagaaggactccgtg
tgtggtgtgtctgagtgcatcatcatgggaatcccaatgaacattggaactggtctcttc
aaactgctacacaaagccaacagggacccaaaaccacccaggaggcccctgatatttgac
acacatgaattccacatccctcttgtcacatag

KEGG   Rattus norvegicus (rat): 361640
Entry
361640            CDS       T01003                                 
Symbol
Polr3e
Name
(RefSeq) DNA-directed RNA polymerase III subunit RPC5
  KO
K14721  DNA-directed RNA polymerase III subunit RPC5
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03020  RNA polymerase
rno04623  Cytosolic DNA-sensing pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    361640 (Polr3e)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    361640 (Polr3e)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:rno03021]
    361640 (Polr3e)
Transcription machinery [BR:rno03021]
 Eukaryotic type
  RNA polymerase III system
   RNA polymerase III
    Pol III specific subunits
     361640 (Polr3e)
SSDB
Motif
Pfam: RPC5 RPC5_C zf-TFIIB
Other DBs
NCBI-GeneID: 361640
NCBI-ProteinID: NP_001101973
RGD: 1308086
Ensembl: ENSRNOG00000016960
UniProt: D3ZP45
LinkDB
Position
1:175466091..175494679
AA seq 708 aa
MANEEDDPVIQEIDVYLAKSLAEKLYLFQYPVRPASMTYDDIPHLSAKIKPKQQKVELEM
AIDTLNPNYCRSKGEQIALNVDGACTDETSTYSSKLMDKQTFCSSQTTSNTARYAAALYR
QGELHLTPLHGILQLRPSFSYLDKADAKHREREAANEAGDSSQDEAEEDVKQITVRFSRP
ESEQARQRRVQSYEFLQKKHAEEPWVHLHYYGMRDSRSEHERQYLLCQGSSGVENTELVK
SPSEYLMMLMPPSPEEEKDKPVAPSNVLSMAQLRTLPLADQIKVLMKNVKVMPFANLMSL
LGPSVDSVAVLRGIQKVAMLVQGNWVVKSDILYPKDSSSPHSGMPAEVLCRGRDFVMWKF
TQSRWVVRKEVAAVTKLCAEDVKDFLEHMAVVRINRGWEFLLPYDLEFIKKHPDVVQRQH
MLWSGIQAKLEKVYNLVKETMPKKPDGPSAPVVSGEQRVQTAKTKAQQNHAFLERELQRR
KEQIRGTTVLPSVQIKEEPLSEEEADGDELEAEEEEPMDTAPSSCLSTKLANGLPAGRAV
GGDSLNGHPIPGCASNPVARELKAFVEATFQRQFVLTLSELKRLFNLHLAGLPPGHTLFS
GVSDRMLQDTVLAAGCKQILVPFPPQTAASPDEQKVFALWESGDMSDQHRQVLLEIFSKN
YRVRRNMIQSRLTQECGEELSKQEVDKVLKDCCVSCGGMWYLKGTVQS
NT seq 2127 nt   +upstreamnt  +downstreamnt
atggccaatgaagaagatgacccagtcatacaggagatcgatgtgtacttggccaaaagt
ctggcagagaagctgtatctctttcagtatcctgttcgtcctgcttcgatgacctatgat
gacattccacatctctcagccaagatcaagcccaaacagcagaaggttgagcttgagatg
gccatcgacaccctgaatcccaactactgccgcagcaaaggggagcagattgcattgaac
gtggatggtgcctgtactgacgagactagcacatattcctcaaagctgatggacaagcag
accttctgctcctcccagaccaccagcaacacggctcgttacgcggctgcactctacagg
caaggcgagctccacctgacgcctttacatggcatcctacagcttcggcccagcttctcc
taccttgataaggcagatgccaagcaccgagagagggaggcggccaatgaggcaggggat
tcttctcaggacgaggcagaagaagatgttaagcagatcacggtacggttctccaggcca
gagtcagagcaggctcgccagcgtcgcgtgcagtcctatgagttcttgcagaagaagcat
gcagaggaaccctgggtccacctacactactatggcatgagggatagccgctcagagcat
gagcgccagtacctgctgtgtcagggatccagcggggtagagaacacggagctcgtcaag
tcgcccagcgaatacctcatgatgctcatgccacccagcccggaggaggagaaggacaag
cccgtagctcccagcaatgtcctgtccatggcccagctgcgtacattgcccctggctgat
cagattaaagtcctgatgaagaacgtgaaagtcatgccttttgctaacctcatgagcctc
ctgggcccctctgtggactctgtggctgttctgcgtggcatccagaaggtggcgatgttg
gtccaaggaaactgggtggtgaaaagtgacatcctgtatcctaaggattcttccagccct
catagtggtatgcctgctgaggtgctctgcaggggccgagactttgtcatgtggaagttc
acacagagccgatgggtggtaagaaaggaggtggcagcagtgaccaaactctgcgctgag
gatgtgaaggactttctggaacacatggctgtagtgaggatcaacagaggctgggagttc
ttactgccttacgacctggagtttatcaagaagcatccagatgtggtccagcggcaacac
atgctgtggtcgggcatccaggccaaattagaaaaagtctataatctcgtaaaagaaacc
atgccaaagaagccggatggaccatcagcgcctgttgtctctggggaacagcgggtccaa
acagccaaaaccaaggcccagcagaaccatgctttcttggagcgtgagctgcagcgacgg
aaggagcagattcggggaaccacagtcctgcccagcgtgcagatcaaggaggaacccctg
agtgaggaggaagccgatggggatgagctggaggctgaggaagaagaacccatggacact
gcacccagtagttgcctcagcaccaagttggccaatgggctgcctgctgggcgggcagtg
ggtggggacagcctaaatgggcacccaattccaggctgtgccagcaacccggttgcccgg
gaactgaaggcttttgtggaagccacctttcagagacagtttgtgctcacgttgagcgaa
ctcaagcgcctcttcaacctgcacctggcaggcctgcccccgggccacacactcttcagt
ggtgtctcagaccgaatgctacaggatacggtgctggccgctggctgcaagcagatactg
gtgccttttcccccacagactgctgcttcccctgatgagcagaaggtatttgccctctgg
gagtctggagacatgagtgaccagcatcgacaggttttgcttgaaatattttccaaaaat
taccgagtacgtcggaatatgatccagtctcggctgactcaagaatgtggagaagagcta
agcaagcaggaggtggataaagtgctaaaggactgttgtgtaagctgtggtggcatgtgg
taccttaaggggacagtacaatcctga

KEGG   Rattus norvegicus (rat): 362858
Entry
362858            CDS       T01003                                 
Symbol
Polr3b
Name
(RefSeq) DNA-directed RNA polymerase III subunit RPC2
  KO
K03021  DNA-directed RNA polymerase III subunit RPC2 [EC:2.7.7.6]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03020  RNA polymerase
rno04623  Cytosolic DNA-sensing pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    362858 (Polr3b)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    362858 (Polr3b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:rno03021]
    362858 (Polr3b)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.6  DNA-directed RNA polymerase
     362858 (Polr3b)
Transcription machinery [BR:rno03021]
 Eukaryotic type
  RNA polymerase III system
   RNA polymerase III
    Core subunits
     362858 (Polr3b)
SSDB
Motif
Pfam: RNA_pol_Rpb2_6 RNA_pol_Rpb2_1 RNA_pol_Rpb2_7 RNA_pol_Rpb2_2 RNA_pol_Rpb2_4 RNA_pol_Rpb2_3 RNA_pol_Rpb2_5
Other DBs
NCBI-GeneID: 362858
NCBI-ProteinID: NP_001178807
RGD: 1565311
Ensembl: ENSRNOG00000007432
UniProt: D3ZV30
LinkDB
Position
7:complement(19039179..19142450)
AA seq 1133 aa
MDVLAEEFGSLTPEELAAPIPTVEEKWRLLPAFLKVKGLVKQHIDSFNYFINVEIKKIMK
ANEKVTSDADPMWYLKYLNIYVGLPDVEESFNVTRPVSPHECRLRDMTYSAPITVDIEYT
RGSQRIIRNALPIGRMPIMLRSSNCVLTGKTPAEFAKLNECPLDPGGYFIVKGVEKVILI
QEQLSKNRIIVEADRKGAVGASVTSSTHEKKSRTNMAVKQGRFYLRHNTLSEDIPIVIIF
KAMGVESDQEIVQMIGTEEHVMAAFGPSLEECQKAQIFTQMQALKYIGNKVRRQRMWGGG
PKKTKIEEARELLASTILTHVPVKEFNFRAKCIYTAVMVRRVILAQGDNKVDDRDYYGNK
RLELAGQLLSLLFEDLFKKFNSEMKKIADQVIPKQRAAQFDVVKHMRQDQITNGMVNAIS
TGNWSLKRFKMDRQGVTQVLSRLSYISALGMMTRISSQFEKTRKVSGPRSLQPSQWGMLC
PSDTPEGEACGLVKNLALMTHITTDMEDGPIIKLAGNLGVEDVNLLCGEELSYPNVFLVF
LNGNILGVIRDHKKLVSTFRLMRRAGYINEFVSISTNLTDRCVYISSDGGRLCRPYIIVK
KQKPAVTNKHMEELAQGYRNFEDFLHESLVEYLDVNEENDCNIALYEHTINKDTTHLEIE
PFTLLGVCAGLIPYPHHNQSPRNTYQCAMGKQAMGTIGYNQRNRIDTLMYLLAYPQKPMV
KTKTIELIDFEKLPAGQNATVAVMSYSGYDIEDALVLNKASLDRGFGRCLVYKNAKCTLK
RYTNQTFDKVMGPMLDAATRKPIWRHEILDADGICSPGEKVENKQVLVNKSMPTVTQIPL
EGSNVPQQPQYKDVPITYKGATDSYIEKVMISSNAEDAFLIKMLLRQTRRPEIGDKFSSR
HGQKGVCGLIVPQEDMPFCDSGICPDIIMNPHGFPSRMTVGKLIELLAGKAGVLDGRFHY
GTAFGGSKVKDVCEDLVRHGYNYLGKDYVTSGITGEPLEAYIYFGPVYYQKLKHMVLDKM
HARARGPRAVLTRQPTEGRSRDGGLRLGEMERDCLIGYGASMLLLERLMISSDAFEVDVC
GQCGLLGYSGWCHYCKSSCHVSSLRIPYACKLLFQELQSMNIIPRLKLAKYNE
NT seq 3402 nt   +upstreamnt  +downstreamnt
atggacgtgctagctgaggagttcgggagcctgactccggaggagctggctgcgccgatc
ccgactgtggaggaaaaatggaggctgcttccagcatttttaaaggtaaaaggcctggtg
aaacagcacatcgactcctttaactatttcattaatgtagagataaagaagataatgaaa
gccaacgaaaaggttacaagcgatgctgatcccatgtggtacttaaagtatcttaatatc
tatgttggacttcctgacgtcgaagaaagcttcaatgtaactagaccagtgtcccctcat
gagtgccgtctgcgggacatgacgtactccgcccccatcaccgtggacatcgagtatacc
cgaggcagccagaggataatccgcaatgccttacccattggcagaatgcccatcatgctc
cgaagttcaaactgtgttctgacagggaaaactccagcagagtttgccaaactcaacgag
tgtccattagacccaggtggctacttcatcgttaaaggagtggagaaagtcattcttatc
caggagcagctgtccaagaacaggatcattgtggaggcagacaggaagggggctgttggg
gcttcagttaccagctccacccacgagaaaaaaagtagaaccaacatggcggtgaaacaa
gggcgcttttatctgaggcataacaccctgtctgaagatatacccattgtcatcatattc
aaggccatgggtgttgagagtgaccaggaaattgtgcagatgattggaacggaggagcac
gtgatggctgcgtttgggcccagcctggaggagtgccagaaagctcagatcttcacccag
atgcaggcgttgaagtatatagggaataaagtaagaagacaaagaatgtggggaggtgga
ccaaagaagaccaaaatagaagaagcaagagaacttctggcctctaccattctgacccat
gtaccagttaaggaattcaatttccgagctaagtgtatctacacggcagtgatggtgcga
agggtgatcttggcccaaggagataacaaggtcgatgacagagactattacggcaacaag
cgactggagctggcaggccagctcttgtctcttctttttgaagatttgtttaaaaagttt
aattcagaaatgaagaagattgcagaccaagtgattcctaaacaaagagcagcccagttt
gacgtcgtgaaacacatgcgccaagaccagattaccaatggcatggtcaatgccatctcc
acgggaaattggtctctgaagagatttaagatggaccggcagggtgtgacccaagtgctg
tctcgcttgtcctatatatctgcacttggcatgatgacaagaatctcttcccagttcgaa
aaaacaagaaaagtgagtggccctcgttctctgcagccatctcagtggggaatgctctgt
ccctccgacacacctgaaggagaggcctgcggtttggttaagaacttggccctcatgaca
catataacaaccgacatggaagatggacccattattaagttagctgggaacttgggagta
gaagatgtgaatttattatgtggagaagagctctcttacccaaatgtattccttgtcttc
ctgaatggtaacatcctgggtgtcattcgagaccataaaaagcttgtgagcacgttccgg
ctgatgcgaagagcaggctacatcaatgaatttgtctccatctccacaaaccttacggac
cgatgtgtttacatttcctctgatggcgggcgcttgtgcaggccttacatcattgtcaag
aaacagaagcccgcagttaccaataagcacatggaagagctggctcaaggttacaggaat
tttgaagatttcttacatgagagtctggttgagtacttagatgtgaatgaagaaaatgat
tgtaacattgcgctctacgaacatacaattaataaagacaccacccacttggagattgaa
cccttcactcttctcggtgtttgcgccggcctgatcccgtaccctcatcacaaccagtct
ccaagaaacacctaccagtgtgccatgggcaagcaagccatgggtaccattggatacaat
cagcgaaacagaattgatacactaatgtatctactagcatatccacaaaaacccatggtt
aaaacaaaaaccattgagttgatagactttgagaaattgccagctgggcagaatgcaact
gttgccgtgatgagctacagcggctatgacattgaagacgcccttgttttgaacaaggcc
tctctggacagaggttttgggcgttgtctcgtctataaaaacgctaagtgcacattgaag
cgatataccaatcagacttttgataaggtgatgggtcccatgttggatgctgctaccaga
aaacccatctggcgacatgaaattttagatgcagatggcatttgttctccaggtgagaaa
gtagaaaacaagcaggtgcttgtaaacaagtccatgcccacagtgactcagattcctctg
gaagggagcaacgtgccacagcagccacagtataaggatgtgcccatcacgtacaaaggt
gcaacagactcttacatcgagaaagtgatgatctcttccaacgctgaggacgctttcctc
atcaagatgctcctgagacagacgcggcgtccagagatcggagacaaattcagcagtcgc
catggacaaaagggtgtctgcggcctgatcgtcccccaagaagacatgccgttctgtgac
tctggcatctgtcccgacatcataatgaaccctcacggcttcccatcgagaatgacggtt
ggaaagttgattgagttgctggccggcaaggcaggcgtgttagacggcaggttccactac
ggcaccgcctttggagggagtaaagtgaaggacgtgtgtgaagacctcgttcgccatggt
tacaactacctggggaaggactatgtcacctcgggcatcaccggtgagcccttagaagcc
tacatctattttgggcctgtgtactatcagaaactgaaacacatggtgctggataaaatg
catgcccgggccagaggaccacgagctgtccttaccaggcagcccactgaagggcgatct
cgcgatggcggcctgcgtcttggagaaatggagcgtgactgtttaattggctatggagcg
agtatgcttttgctggagagactaatgatctcaagtgatgccttcgaagttgacgtctgt
gggcagtgtggactacttggatattctggctggtgtcactactgcaagtcctcgtgccac
gtgtcctccctccgcatcccatatgcctgcaagctgctcttccaggagttgcagtccatg
aacatcatccccaggttgaaactggccaagtacaacgagtaa

KEGG   Rattus norvegicus (rat): 366277
Entry
366277            CDS       T01003                                 
Symbol
Polr3k
Name
(RefSeq) DNA-directed RNA polymerase III subunit RPC10
  KO
K03019  DNA-directed RNA polymerase III subunit RPC11
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03020  RNA polymerase
rno04623  Cytosolic DNA-sensing pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    366277 (Polr3k)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    366277 (Polr3k)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:rno03021]
    366277 (Polr3k)
Transcription machinery [BR:rno03021]
 Eukaryotic type
  RNA polymerase III system
   RNA polymerase III
    Pol III specific subunits
     366277 (Polr3k)
SSDB
Motif
Pfam: TFIIS_C RNA_POL_M_15KD Lar_restr_allev zf-SAP30 Baculo_LEF5_C Zn_ribbon_recom
Other DBs
NCBI-GeneID: 366277
NCBI-ProteinID: NP_001014281
RGD: 1587294
Ensembl: ENSRNOG00000017843
UniProt: Q5FVH1
LinkDB
Position
3:168982846..168987043
AA seq 108 aa
MLLFCPGCGNGLIVEEGQRCHRFACNTCPYVHNITRKVTNRKYPKLKEVDDVLGGAAAWE
NVDSTAEPCPKCEHPRAYFMQLQTRSADEPMTTFYKCCNAQCGHRWRD
NT seq 327 nt   +upstreamnt  +downstreamnt
atgctgctgttctgcccgggctgcgggaacggcctcattgtggaggaggggcagcgctgt
caccgcttcgcctgcaacacgtgcccgtacgtccataacatcacccgcaaggtaacaaac
cgaaagtatccaaagctaaaagaagtggatgatgtgcttggtggagcagctgcctgggag
aatgtggactctactgcagagccatgtccaaaatgtgagcatcctcgtgcctacttcatg
cagcttcagacccgttctgcggacgagccaatgaccaccttctataagtgctgcaatgct
cagtgtggacatcgctggagggattag

DBGET integrated database retrieval system