KEGG   Rattus norvegicus (rat): 100364027
Entry
100364027         CDS       T01003                                 

Gene name
Hkdc1
Definition
(RefSeq) hexokinase HKDC1 isoform X1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00010  Glycolysis / Gluconeogenesis
rno00051  Fructose and mannose metabolism
rno00052  Galactose metabolism
rno00500  Starch and sucrose metabolism
rno00520  Amino sugar and nucleotide sugar metabolism
rno00524  Neomycin, kanamycin and gentamicin biosynthesis
rno01100  Metabolic pathways
rno01200  Carbon metabolism
rno04066  HIF-1 signaling pathway
rno04910  Insulin signaling pathway
rno04930  Type II diabetes mellitus
rno04973  Carbohydrate digestion and absorption
rno05230  Central carbon metabolism in cancer
Module
rno_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
rno_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
rno_M00892  UDP-N-acetyl-D-glucosamine biosynthesis, eukaryotes, glucose => UDP-GlcNAc
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100364027 (Hkdc1)
   00051 Fructose and mannose metabolism
    100364027 (Hkdc1)
   00052 Galactose metabolism
    100364027 (Hkdc1)
   00500 Starch and sucrose metabolism
    100364027 (Hkdc1)
   00520 Amino sugar and nucleotide sugar metabolism
    100364027 (Hkdc1)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    100364027 (Hkdc1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    100364027 (Hkdc1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100364027 (Hkdc1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100364027 (Hkdc1)
 09160 Human Diseases
  09161 Cancer: overview
   05230 Central carbon metabolism in cancer
    100364027 (Hkdc1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100364027 (Hkdc1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    100364027 (Hkdc1)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     100364027 (Hkdc1)
Membrane trafficking [BR:rno04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    100364027 (Hkdc1)
SSDB
Motif
Pfam: Hexokinase_2 Hexokinase_1 VPS13_mid_rpt CSD
Other DBs
NCBI-GeneID: 100364027
NCBI-ProteinID: XP_038955090
RGD: 2321830
LinkDB
Position
20
AA seq 915 aa
MFAVHLVAFYFTKLKEDQIKKVDRFLYHMRLSDETLVDIMARFQAEMEKGLGKDTNPTAS
VKMLPTFVRAIPDGSENGEFLSLDLGGSKFRVLKVQVSEEGKQNVQMESQFYPMPNEITR
GNGTELFDYVADCLADFMKTKDLTHKKLPLGFTFSFPCRQNKLEEGFLLSWTKKFKARGV
QDTDVVNRLATAMKKHKDLDVDILALVNDTVGTMMTCAYDDPNCEVGVIIGTGTNACYME
DMSNIDLVEGDEGRMCINTEWGAFGDDGTLEDIRTEFDRELDLGSLNPGKQLFEKMISGL
YMGELVRLILLKMAKVGLLFGGAKSSALHTKGKIETQHVAAMEMSKEGLANTREILVDLG
LDPSESDCIAVQHVCTIVSFRSANLCAAALAAILTRLRENKKLARLRTTVGMDGTLYKTH
PQYPKRLHKVVRRLVPNCDVRFLLSESGSTKGAAMVTAVASRVQAQRKQIDKVLALFHLT
REQLLGVRDKMRAELEYGLKKKTHALATVKMLPTYVYGMPDGTEKGKFLALDLGGTNFRV
LLVKIRKRSVRMYNKIFAIPLEIMQGTGEELFDHIVQCIADFLDYMGLKGAQLPLGFTFS
FPCRQTCIDKGTLVGWTKGFKATDCEGEDVVDMLREAIKRRNEFDLDIVAIVNDTVGTMM
TCGYEDPRCEIGLIAGTGSNVCYMEEMRNIELVDGDEGRMCVNTEWGGFGDNGCIDDIRT
QYDKEVDEGSLNAGKQRYEKMTSGMYLGEIVRRILIDLTRQGLLFRGQISERLRTRGIFE
TKFLSQIESDRLALLQVRRILQQLGLDSTCEDSIVVKEVCGAVSRRAAQMCGAGMAAIVE
KRREDQGLQHFKVTVGVDGTLYKLHPHFSRILQETVKDLAPQCDVTFMLSEDGSGKGAAL
ITAVAKRLQQLPKDN
NT seq 2748 nt   +upstreamnt  +downstreamnt
atgtttgcagttcacttagtggcgttttacttcaccaagctgaaagaggaccagatcaag
aaggtggacaggttcctgtaccatatgcggctctcggatgagacccttgtggacatcatg
gcccgattccaggccgagatggagaaaggcttagggaaggacaccaaccccactgcctca
gtgaagatgctgcccacattcgtcagggccattccagatggctcagaaaacggggaattc
ctttccctggatctcggagggtccaagtttcgggtcctgaaggtgcaagtctcggaagag
ggcaagcaaaatgtccagatggagagccagttctacccaatgcccaatgaaatcacccgt
gggaatggcacggagctctttgactatgtagctgactgcctggcagatttcatgaagacc
aaagatctgacgcacaagaagctgcctctgggcttcaccttttcttttccctgcagacag
aataagttggaggagggcttcctgctgtcatggaccaagaagttcaaggcccggggagtt
caggacacagacgtggtgaaccgtctggccaccgccatgaaaaagcacaaggacctggac
gtggacatcctggccttggttaacgacactgtggggaccatgatgacttgtgcttatgat
gatcccaactgtgaggtcggcgttatcattggaacaggcaccaacgcgtgttacatggag
gacatgagcaacatcgaccttgtggaaggggacgagggaaggatgtgcatcaacacggag
tggggggccttcggggacgatggcactttggaggacattcgcaccgagtttgacagagag
ttggacctgggctcactcaaccccgggaagcagctgttcgagaagatgatcagcgggctg
tacatgggggagctggtcaggctcatcttgctgaagatggccaaagttggtctcctgttt
gggggtgcaaagtcctccgctctccacacaaagggcaagattgaaacacagcacgtggct
gccatggagatgagtaaagaaggcctggccaatacgagagagatcctggtggatttgggc
ctggacccctctgagtcagactgcatcgctgtccagcacgtgtgcaccatcgtctctttt
cgctcggccaatctctgcgccgctgcgctggcagccatcttgactcgcctccgagagaac
aagaagctggcccggctccgcaccacggtgggcatggatggaaccctctacaaaacacac
cctcagtaccccaaacgcctacacaaagtggtgaggaggctggtcccaaactgtgatgtc
cgcttcctcctatcagagagcggaagcaccaaaggggctgccatggtgaccgcagtggcc
tctcgggtgcaggcccagcgtaagcagatcgataaggtgctggctttgttccatttgacc
cgagagcaactcctgggtgtgcgggacaagatgcgggctgaacttgagtatgggctgaag
aaaaaaactcacgctctggctacagtgaagatgcttcccacctacgtctatgggatgccc
gatggcacagagaaaggaaagttccttgccctggacttggggggaactaacttccgcgtc
ctccttgtaaagatcaggaagaggtcggtgcgaatgtacaacaagatctttgccatccct
ctggagatcatgcagggcactggagaggagctctttgaccacattgtgcagtgcatcgct
gacttcctggactatatgggcctcaagggcgcccagctgcctttgggcttcacattctcc
ttcccctgcagacaaacatgcatcgacaaggggactctagtaggatggaccaaaggcttc
aaggccaccgactgtgaaggggaggacgtggtggacatgctcagagaagccatcaagagg
agaaacgagtttgacctggacatagttgcaatcgtgaatgacacggtggggaccatgatg
acctgtggctatgaggatccccggtgtgagattggcttgattgcagggacaggaagcaac
gtgtgctacatggaagaaatgaggaacattgagctggtggacggggatgaaggccggatg
tgcgtcaacacggagtggggcgggtttggcgacaacggctgcatagatgacatccgcacg
cagtacgacaaggaggtggatgagggctccctgaatgccggcaaacagaggtacgagaaa
atgaccagtgggatgtacctgggggagattgtgaggcggatcctgatcgacctcacccgg
caggggctcctcttccgagggcagatttcagagcgactccggaccaggggtatctttgaa
accaaattcctgtctcagattgaaagtgaccggctggccctcctgcaggtcaggaggatc
ctgcagcagctgggcctggacagcacctgcgaagacagcattgtggtgaaggaggtgtgc
ggggctgtgtctcggagggctgcccagatgtgcggcgccggcatggctgccatcgtggag
aaaaggagagaagaccagggcctccagcacttcaaggtcactgtgggcgtggacggcacc
ctgtacaagctgcacccacacttctcccggatactgcaggagacagtgaaggacctggct
cctcagtgcgacgtgactttcatgttgtcagaagacggcagcgggaagggagcagctctg
atcacagctgtagccaagaggttacagcagctgccgaaggacaactag

KEGG   Rattus norvegicus (rat): 24385
Entry
24385             CDS       T01003                                 

Gene name
Gck
Definition
(RefSeq) hexokinase-4 isoform 2
  KO
K12407  glucokinase [EC:2.7.1.2]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00010  Glycolysis / Gluconeogenesis
rno00052  Galactose metabolism
rno00500  Starch and sucrose metabolism
rno00520  Amino sugar and nucleotide sugar metabolism
rno00524  Neomycin, kanamycin and gentamicin biosynthesis
rno01100  Metabolic pathways
rno01200  Carbon metabolism
rno04910  Insulin signaling pathway
rno04911  Insulin secretion
rno04917  Prolactin signaling pathway
rno04922  Glucagon signaling pathway
rno04930  Type II diabetes mellitus
rno04950  Maturity onset diabetes of the young
rno05230  Central carbon metabolism in cancer
Module
rno_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
rno_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
rno_M00892  UDP-N-acetyl-D-glucosamine biosynthesis, eukaryotes, glucose => UDP-GlcNAc
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    24385 (Gck)
   00052 Galactose metabolism
    24385 (Gck)
   00500 Starch and sucrose metabolism
    24385 (Gck)
   00520 Amino sugar and nucleotide sugar metabolism
    24385 (Gck)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    24385 (Gck)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    24385 (Gck)
   04910 Insulin signaling pathway
    24385 (Gck)
   04922 Glucagon signaling pathway
    24385 (Gck)
   04917 Prolactin signaling pathway
    24385 (Gck)
 09160 Human Diseases
  09161 Cancer: overview
   05230 Central carbon metabolism in cancer
    24385 (Gck)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    24385 (Gck)
   04950 Maturity onset diabetes of the young
    24385 (Gck)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     24385 (Gck)
SSDB
Motif
Pfam: Hexokinase_2 Hexokinase_1
Other DBs
NCBI-GeneID: 24385
NCBI-ProteinID: NP_036697
RGD: 2670
Ensembl: ENSRNOG00000061527
UniProt: P17712 Q64596
LinkDB
Position
14
AA seq 465 aa
MAMDTTRCGAQLLTLVEQILAEFQLQEEDLKKVMSRMQKEMDRGLRLETHEEASVKMLPT
YVRSTPEGSEVGDFLSLDLGGTNFRVMLVKVGEGEAGQWSVKTKHQMYSIPEDAMTGTAE
MLFDYISECISDFLDKHQMKHKKLPLGFTFSFPVRHEDLDKGILLNWTKGFKASGAEGNN
IVGLLRDAIKRRGDFEMDVVAMVNDTVATMISCYYEDRQCEVGMIVGTGCNACYMEEMQN
VELVEGDEGRMCVNTEWGAFGDSGELDEFLLEYDRMVDESSANPGQQLYEKIIGGKYMGE
LVRLVLLKLVDENLLFHGEASEQLRTRGAFETRFVSQVESDSGDRKQIHNILSTLGLRPS
VTDCDIVRRACESVSTRAAHMCSAGLAGVINRMRESRSEDVMRITVGVDGSVYKLHPSFK
ERFHASVRRLTPNCEITFIESEEGSGRGAALVSAVACKKACMLAQ
NT seq 1398 nt   +upstreamnt  +downstreamnt
atggctatggatactacaaggtgtggagcccagttgttgactctggtcgagcagatcctg
gcagagttccagctgcaggaggaagacctgaagaaggtgatgagccggatgcagaaggag
atggaccgtggcctgaggctggagacccacgaggaggccagtgtaaagatgttacccacc
tacgtgcgttccaccccagaaggctcagaagtcggagactttctctccttagacctggga
ggaaccaacttcagagtgatgctggtcaaagtgggagagggggaggcagggcagtggagc
gtgaagacaaaacaccagatgtactccatccccgaggacgccatgacgggcactgccgag
atgctctttgactacatctctgaatgcatctctgacttccttgacaagcatcagatgaag
cacaagaaactgcccctgggcttcaccttctccttccctgtgaggcacgaagacctagac
aagggcatcctcctcaattggaccaagggcttcaaggcctctggagcagaagggaacaac
atcgtaggacttctccgagatgctatcaagaggagaggggactttgagatggatgtggtg
gcaatggtgaacgacacagtggccacaatgatctcctgctactatgaagaccgccaatgt
gaggtcggcatgattgtgggcactggctgcaatgcctgctacatggaggaaatgcagaat
gtggagctggtggaaggggatgagggacgcatgtgcgtcaacacggagtggggcgccttc
ggggactcgggcgagctggatgagttcctactggagtatgaccggatggtggatgaaagc
tcagcgaaccccggtcagcagctgtacgagaagatcatcggtgggaagtatatgggcgag
ctggtacgacttgtgctgcttaagctggtggacgagaaccttctgttccacggagaggcc
tcggagcagctgcgcacgcgtggtgcttttgagacccgtttcgtgtcacaagtggagagc
gactccggggaccgaaagcagatccacaacatcctaagcactctggggcttcgaccctct
gtcaccgactgcgacattgtgcgccgtgcctgtgaaagcgtgtccactcgcgccgcccat
atgtgctccgcaggactagctggggtcataaatcgcatgcgcgaaagccgcagtgaggac
gtgatgcgcatcactgtgggcgtggatggctccgtgtacaagctgcacccgagcttcaag
gagcggtttcacgccagtgtgcgcaggctgacacccaactgcgaaatcaccttcatcgaa
tcagaggagggcagcggcaggggagccgcgctggtctctgcggtggcctgcaagaaggct
tgcatgctggcccagtga

KEGG   Rattus norvegicus (rat): 25058
Entry
25058             CDS       T01003                                 

Gene name
Hk1
Definition
(RefSeq) hexokinase-1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00010  Glycolysis / Gluconeogenesis
rno00051  Fructose and mannose metabolism
rno00052  Galactose metabolism
rno00500  Starch and sucrose metabolism
rno00520  Amino sugar and nucleotide sugar metabolism
rno00524  Neomycin, kanamycin and gentamicin biosynthesis
rno01100  Metabolic pathways
rno01200  Carbon metabolism
rno04066  HIF-1 signaling pathway
rno04910  Insulin signaling pathway
rno04930  Type II diabetes mellitus
rno04973  Carbohydrate digestion and absorption
rno05230  Central carbon metabolism in cancer
Module
rno_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
rno_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
rno_M00892  UDP-N-acetyl-D-glucosamine biosynthesis, eukaryotes, glucose => UDP-GlcNAc
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    25058 (Hk1)
   00051 Fructose and mannose metabolism
    25058 (Hk1)
   00052 Galactose metabolism
    25058 (Hk1)
   00500 Starch and sucrose metabolism
    25058 (Hk1)
   00520 Amino sugar and nucleotide sugar metabolism
    25058 (Hk1)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    25058 (Hk1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    25058 (Hk1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    25058 (Hk1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    25058 (Hk1)
 09160 Human Diseases
  09161 Cancer: overview
   05230 Central carbon metabolism in cancer
    25058 (Hk1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    25058 (Hk1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    25058 (Hk1)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     25058 (Hk1)
Membrane trafficking [BR:rno04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    25058 (Hk1)
SSDB
Motif
Pfam: Hexokinase_2 Hexokinase_1 Sec23_helical
Other DBs
NCBI-GeneID: 25058
NCBI-ProteinID: NP_036866
RGD: 2796
UniProt: P05708
LinkDB
Structure
PDB: 
1BG3

Position
20
AA seq 918 aa
MIAAQLLAYYFTELKDDQVKKIDKYLYAMRLSDEILIDILTRFKKEMKNGLSRDYNPTAS
VKMLPTFVRSIPDGSEKGDFIALDLGGSSFRILRVQVNHEKNQNVSMESEIYDTPENIVH
GSGTQLFDHVADCLGDFMEKKKIKDKKLPVGFTFSFPCRQSKIDEAVLITWTKRFKASGV
EGADVVKLLNKAIKKRGDYDANIVAVVNDTVGTMMTCGYDDQQCEVGLIIGTGTNACYME
ELRHIDLVEGDEGRMCINTEWGAFGDDGSLEDIRTEFDRELDRGSLNPGKQLFEKMVSGM
YMGELVRLILVKMAKEGLLFEGRITPELLTRGKFNTSDVSAIEKDKEGIQNAKEILTRLG
VEPSDVDCVSVQHICTIVSFRSANLVAATLGAILNRLRDNKGTPRLRTTVGVDGSLYKMH
PQYSRRFHKTLRRLVPDSDVRFLLSESGTGKGAAMVTAVAYRLAEQHRQIEETLAHFRLS
KQTLMEVKKRLRTEMEMGLRKETNSKATVKMLPSFVRSIPDGTEHGDFLALDLGGTNFRV
LLVKIRSGKKRTVEMHNKIYSIPLEIMQGTGDELFDHIVSCISDFLDYMGIKGPRMPLGF
TFSFPCHQTNLDCGILISWTKGFKATDCEGHDVASLLRDAVKRREEFDLDVVAVVNDTVG
TMMTCAYEEPTCEIGLIVGTGTNACYMEEMKNVEMVEGNQGQMCINMEWGAFGDNGCLDD
IRTDFDKVVDEYSLNSGKQRFEKMISGMYLGEIVRNILIDFTKKGFLFRGQISEPLKTRG
IFETKFLSQIESDRLALLQVRAILQQLGLNSTCDDSILVKTVCGVVSKRAAQLCGAGMAA
VVEKIRENRGLDHLNVTVGVDGTLYKLHPHFSRIMHQTVKELSPKCTVSFLLSEDGSGKG
AALITAVGVRLRGDPSIA
NT seq 2757 nt   +upstreamnt  +downstreamnt
atgatcgccgcgcaactactggcctattacttcaccgagctgaaggatgaccaagtcaaa
aagattgacaagtatctgtacgccatgcggctctctgatgagattctgatagatatcctg
acacgattcaagaaagagatgaagaatggcctctcccgggattataatccaacagcctcc
gtcaagatgctgcccaccttcgtccggtccattccggacggctcagaaaagggggatttc
attgccctggatctcggcgggtcttcctttcgaatcctgcgggtgcaggtgaaccacgag
aagaaccagaacgtcagcatggagtctgagatctacgacaccccagagaacatcgtgcat
ggcagtggaacccagcttttcgatcatgtcgctgactgcctgggagacttcatggagaaa
aagaagatcaaggacaagaagttacccgtgggattcacattttccttcccctgccgacaa
tccaagatagatgaggctgtactgatcacgtggacaaagcggttcaaagccagtggcgtg
gaaggagcggatgtggtcaagttgctgaataaagccattaagaagcgaggggactatgat
gctaacattgtcgccgtggtgaatgacacagtagggaccatgatgacctgcggttatgat
gaccaacagtgtgaagtcggcctgatcattggcacaggcaccaatgcttgctacatggag
gaactgcgacacatcgacctggtggaaggcgacgaggggaggatgtgtattaacacggaa
tggggagcctttggggatgatgggtccctggaagacatccgaaccgagtttgacagagag
ttagaccgtggatctctcaaccctgggaagcagctgttcgagaagatggtgagcggcatg
tacatgggggagctggtccggctaatcctggtgaagatggccaaggaaggcctcttattc
gaagggcgcatcactccagagctgctcacgaggggaaagttcaacactagtgacgtgtcc
gccattgaaaaggataaggaaggcattcaaaatgccaaggaaatcttaacccgcttggga
gtggagccgtctgatgttgactgtgtgtcggtccagcacatctgcacgatcgtctccttc
cgatcagccaacctggtggccgccacgctcggtgccatcttgaaccgcctgcgggacaac
aagggcacaccacgcctgcggaccacggttggcgtggacggttctctctacaagatgcac
ccacagtactcccggcggttccacaagaccctgaggcgcctggtgcctgactccgacgtc
cgtttcctcctctcagagagtggcacgggcaagggggccgccatggtgacggcagtagcc
taccgcctggctgagcagcaccggcagattgaggaaaccctggcccacttccgcctcagc
aagcagacgctgatggaggtgaagaagaggctacggacagagatggaaatggggctgagg
aaggagaccaacagcaaagctactgtcaaaatgctgccttcttttgtccggagcatcccg
gatgggactgaacacggtgacttcctggccttggatcttggaggaacgaatttccgggtt
ctgctggtaaagatccgcagtgggaaaaagagaacagtggaaatgcacaacaagatctac
tccattcccctggaaatcatgcagggcaccggggatgagctgtttgaccacatcgtctcc
tgcatctctgacttcctggactacatggggatcaaaggcccccggatgcctctgggcttc
accttctcatttccctgccatcagacgaacctggactgtggaatcttgatctcatggaca
aagggtttcaaagccactgactgtgagggccatgatgtagcctccttactgagggatgcg
gtgaagaggagagaggaatttgacttggatgtggtggctgtggtcaacgacaccgtgggc
accatgatgacctgtgcgtatgaagaacccacttgcgaaattggactcatcgtggggacg
ggcaccaatgcctgctacatggaggagatgaagaatgtggagatggtggaggggaaccag
ggccagatgtgcatcaacatggagtggggcgccttcggtgacaatgggtgtctggatgac
atcagaacagactttgacaaagtggtggacgaatattctctaaactctgggaaacaaagg
tttgagaaaatgatcagtgggatgtacctgggtgagatcgtccgtaacatcctgattgac
ttcaccaagaaaggcttcctcttccggggacagatctccgaaccactcaagacccgaggc
atctttgagaccaagtttctctctcagattgagagtgaccggttagcgctgctccaggtg
cgggccatccttcagcagctgggtttgaacagcacgtgtgacgacagtatcctggtcaag
accgtgtgtggggtggtgtccaagagggcggctcagctgtgtggtgccggcatggccgcc
gtggtggaaaagatcagagagaacagaggcctagaccatctgaatgtaactgtgggagtg
gatgggacgctctacaaacttcatccacacttctccagaatcatgcaccaaactgtgaag
gaactgtcaccaaagtgtaccgtgtccttcctcctgtctgaagacggcagcggcaagggg
gccgcccttatcacagctgtgggcgtgcggctcagaggagacccttcgatcgcctaa

KEGG   Rattus norvegicus (rat): 25059
Entry
25059             CDS       T01003                                 

Gene name
Hk2
Definition
(RefSeq) hexokinase-2
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00010  Glycolysis / Gluconeogenesis
rno00051  Fructose and mannose metabolism
rno00052  Galactose metabolism
rno00500  Starch and sucrose metabolism
rno00520  Amino sugar and nucleotide sugar metabolism
rno00524  Neomycin, kanamycin and gentamicin biosynthesis
rno01100  Metabolic pathways
rno01200  Carbon metabolism
rno04066  HIF-1 signaling pathway
rno04910  Insulin signaling pathway
rno04930  Type II diabetes mellitus
rno04973  Carbohydrate digestion and absorption
rno05230  Central carbon metabolism in cancer
Module
rno_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
rno_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
rno_M00892  UDP-N-acetyl-D-glucosamine biosynthesis, eukaryotes, glucose => UDP-GlcNAc
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    25059 (Hk2)
   00051 Fructose and mannose metabolism
    25059 (Hk2)
   00052 Galactose metabolism
    25059 (Hk2)
   00500 Starch and sucrose metabolism
    25059 (Hk2)
   00520 Amino sugar and nucleotide sugar metabolism
    25059 (Hk2)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    25059 (Hk2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    25059 (Hk2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    25059 (Hk2)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    25059 (Hk2)
 09160 Human Diseases
  09161 Cancer: overview
   05230 Central carbon metabolism in cancer
    25059 (Hk2)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    25059 (Hk2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    25059 (Hk2)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     25059 (Hk2)
Membrane trafficking [BR:rno04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    25059 (Hk2)
SSDB
Motif
Pfam: Hexokinase_2 Hexokinase_1 FGGY_N
Other DBs
NCBI-GeneID: 25059
NCBI-ProteinID: NP_036867
RGD: 2797
Ensembl: ENSRNOG00000006116
UniProt: P27881
LinkDB
Position
4
AA seq 917 aa
MIASHMIACLFTELNQNQVQKVDQFLYHMRLSDETLLEISRRFRKEMEKGLGATTHPTAA
VKMLPTFVRSTPDGTEHGEFLALDLGGTNFRVLRVRVTDNGLQRVEMENQIYAIPEDIMR
GSGTQLFDHIAECLANFMDKLQIKEKKLPLGFTFSFPCHQTKLDESFLVSWTKGFKSSGV
EGRDVVDLIRKAIQRRGDFDIDIVAVVNDTVGTMMTCGYDDQNCEIGLIVGTGSNACYME
EMRHIDMVEGDEGRMCINMEWGAFGDDGTLNDIRTEFDREIDMGSLNPGKQLFEKMISGM
YMGELVRLILVKMAKAELLFQGKLSPELLTTGSFETKDVSDIEEDKDGIEKAYQILMRLG
LNPLQEDCVATHRICQIVSTRSASLCAATLAAVLWRIKENKGEERLRSTIGVDGSVYKKH
PHFAKRLHKAVRRLVPDCDVRFLRSEDGSGKGAAMVTAVAYRLADQHRARQKTLESLKLS
HEQLLEVKRRMKVEMEQGLSKETHAVAPVKMLPTYVCATPDGTEKGDFLALDLGGTNFRV
LLVRVRNGKRRGVEMHNKIYSIPQEVMHGTGEELFDHIVQCIADFLEYMGMKGVSLPLGF
TFSFPCQQNSLDQSILLKWTKGFKASGCEGEDVVTLLKEAIHRREEFDLDVVAVVNDTVG
TMMTCGYEDPHCEVGLIVGTGSNACYMEEMRNVELVDGEEGRMCVNMEWGAFGDNGCLDD
LRTVFDVAVDELSLNPGKQRFEKMISGMYLGEIVRNILIDFTKRGLLFRGRISERLKTRG
IFETKFLSQIESDCLALLQVRAILRHLGLESTCDDSIIVKEVCTVVARRAAQLCGAGMAA
VVDKIRENRGLDNLKVTVGVDGTLYKLHPHFAKVMHETVRDLAPKCDVSFLESEDGSGKG
AALITAVACRIREAGQR
NT seq 2754 nt   +upstreamnt  +downstreamnt
atgatcgcctcgcatatgatcgcctgcttattcacggagctcaaccaaaaccaagtgcag
aaggttgaccaatttctctaccacatgcgtctctcagatgagacccttctggagatttct
aggcggttccggaaggagatggagaaagggctaggagctaccacgcaccctacagcagct
gtgaaaatgttgcctacctttgtgaggtcaactccggatgggacagaacatggggagttc
ctggctctggatcttggaggaaccaacttccgtgtgctccgagtaagggtgacggacaat
ggcctccagagagtggagatggagaaccagatctacgccatccctgaggacatcatgcgg
ggcagtggaacccagctgtttgaccacatcgccgaatgcctggccaacttcatggacaag
ctacaaatcaaagagaagaagctccctctgggtttcaccttctcgttcccctgccaccag
acaaaactggatgagagttttttggtctcgtggactaaggggttcaagtccagtggcgtg
gaaggcagagatgtggtggacctgatccggaaggctatccagcgcagaggggactttgac
attgacattgtggccgtggtgaatgacacagttgggaccatgatgacttgtggctatgat
gatcagaactgcgagattggtctcattgtgggcactggcagcaacgcctgctacatggag
gaaatgcgtcatattgacatggtggagggagatgaggggcgcatgtgcatcaacatggag
tggggagcctttggggacgacggtacactcaatgacatccgaaccgagtttgaccgagag
atcgacatgggctcgctgaaccctgggaagcagctgtttgagaagatgattagcgggatg
tacatgggggagctggtcaggctcatcctggtgaagatggccaaggcagagctgttgttc
caagggaaactcagcccagaactccttaccactggctccttcgagaccaaagatgtctcg
gatattgaagaggataaggatggaatcgagaaggcctaccaaatcctgatgcgcctgggt
ctgaatccattgcaggaggattgtgtggccacgcaccgaatctgccagattgtgtccacg
cgctcggccagtctgtgcgcagccaccctggccgcggtgctgtggcgaatcaaagagaac
aagggcgaggagcgacttcgctccaccatcggtgtcgatggctccgtctacaagaaacat
ccccattttgccaagcgtctccataaggcagtgaggaggctggtgcccgactgtgatgtc
cgcttcctccgctctgaggatggcagcggcaagggggctgctatggtgacggcggtggct
taccgtctggctgaccaacaccgggcccgccagaagaccctggagtctctgaagctgagc
cacgagcagcttctggaggttaagagaagaatgaaggtggaaatggagcagggtctgagc
aaggagacgcatgcggtcgcccctgtgaagatgctgcccacttacgtgtgtgccactcca
gatggcacagagaaaggagacttcttggccttggatcttggaggaacaaacttccgggtc
ctgctggtgcgtgtgcgtaatggcaagcggaggggcgtggagatgcataacaagatctac
tccatcccacaggaggttatgcatggcactggggaagagctcttcgaccacattgtccag
tgcattgcggacttcctggagtacatgggcatgaagggcgtgtccctgcctttgggtttc
acattctccttcccttgccagcagaacagcctagaccagagcatcctcctcaagtggaca
aagggattcaaggcatctggctgcgagggtgaggatgtggtcaccttgctgaaggaagcg
attcaccggcgagaggagtttgacctggatgtggttgccgtggtgaatgacacagttggg
actatgatgacttgtggctacgaagaccctcactgtgaagttggcctcattgttggcacc
ggaagcaacgcctgctacatggaagagatgcgtaatgtggagctggtggacggagaggag
ggacggatgtgtgtcaacatggagtggggagcatttggggacaatggctgcctggatgac
ttgcggaccgtgtttgatgttgctgtggatgagctttctctcaaccctggcaaacagagg
ttcgagaagatgatcagcggcatgtacttgggagagattgtgcgcaacattctcatcgat
ttcacgaagcgggggctgctcttccgaggccgcatctcagagcgcctcaagacaagggga
atctttgaaactaagttcctgtctcagatagagagcgactgcctagccctgctacaggtt
cgtgccatcctgcgccacctagggctggagagcacgtgcgatgacagcatcatcgtgaag
gaggtgtgcactgtggttgcccggcgcgctgcacagctctgtggcgcaggcatggccgcc
gtagtggacaagataagagagaaccgtgggctggacaacctcaaagtgacagtgggcgtg
gacgggactctgtataagcttcatcctcactttgccaaggtcatgcatgagacggtgaga
gatctggctccgaaatgtgacgtgtccttcctggaatccgaggacggcagtgggaaggga
gcagctctcatcactgccgtggcctgccgcatccgggaggctgggcagagatag

KEGG   Rattus norvegicus (rat): 25060
Entry
25060             CDS       T01003                                 

Gene name
Hk3
Definition
(RefSeq) hexokinase-3
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00010  Glycolysis / Gluconeogenesis
rno00051  Fructose and mannose metabolism
rno00052  Galactose metabolism
rno00500  Starch and sucrose metabolism
rno00520  Amino sugar and nucleotide sugar metabolism
rno00524  Neomycin, kanamycin and gentamicin biosynthesis
rno01100  Metabolic pathways
rno01200  Carbon metabolism
rno04066  HIF-1 signaling pathway
rno04910  Insulin signaling pathway
rno04930  Type II diabetes mellitus
rno04973  Carbohydrate digestion and absorption
rno05230  Central carbon metabolism in cancer
Module
rno_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
rno_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
rno_M00892  UDP-N-acetyl-D-glucosamine biosynthesis, eukaryotes, glucose => UDP-GlcNAc
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    25060 (Hk3)
   00051 Fructose and mannose metabolism
    25060 (Hk3)
   00052 Galactose metabolism
    25060 (Hk3)
   00500 Starch and sucrose metabolism
    25060 (Hk3)
   00520 Amino sugar and nucleotide sugar metabolism
    25060 (Hk3)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    25060 (Hk3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    25060 (Hk3)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    25060 (Hk3)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    25060 (Hk3)
 09160 Human Diseases
  09161 Cancer: overview
   05230 Central carbon metabolism in cancer
    25060 (Hk3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    25060 (Hk3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    25060 (Hk3)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     25060 (Hk3)
Membrane trafficking [BR:rno04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    25060 (Hk3)
SSDB
Motif
Pfam: Hexokinase_2 Hexokinase_1
Other DBs
NCBI-GeneID: 25060
NCBI-ProteinID: NP_071515
RGD: 2798
Ensembl: ENSRNOG00000026235
UniProt: P27926
LinkDB
Position
17
AA seq 924 aa
MAAIEPSGLHPGERDSSCPQEGIPRPSGSLELAQEYLQQFKVTMTQLQQIQASLLCSMEQ
ALKGQDSPAPSVRMLPTYVRSTPHGTEQGDFLVLELGATGASLRVLWVTLTGTKEHSVET
RSQEFVIPQEVILGAGQQLFDFAARCLSEFLDAYPVENQGLKLGFNFSFPCHQTGLDKST
LISWTKGFRCSGVEGQDVVQLLRDAIQRQGTYNIDVVAMVNDTVGTMMGCELGTRPCEVG
LIVDTGTNACYMEEARHVAALDEDRGRTCVSIEWGSFYDEEALGPVLTTFDDALDHESLV
PGAQRFEKMIGGLYLGELVRLVLVHLSQHGVLFGGCASPALLSQNSILLEHVAKMEDPAT
GIAHVHTVLQGLGLSPQASDAELVQRVCMAVCTRAAQLCASALAAVLSRLQHSREQQTLH
VAVATGGRVFEWHPRFLCILKETVMLLAPECDVSFIPSVDGGGRGVAMVTAVAARLATHR
RILEETLAPFQLSLEQLTAVQAQMREAMIRGLQGESSSLRMLPTYVRATPDGSERGDFLA
LDLGGTNFRVLLVRVAEGSVQITNQVYSIPEYVAQGSGQKLFDHIVDCIVDFQKRQGLSG
QSLPLGFTFSFPCKQLGLDQGILLNWTKGFNASGCEGQDVVYLLREAIRRRQAVELNVVA
IVNDTVGTMMSCGYDDPCCEMGLIVGTGTNACYMEELRNVASVPGDSGHMCINMEWGAFG
DDGSLSMLGTCFDASVDQASINPGKQRFEKMISGMYLGEIVRHILLHLTSLGVLFRGQKT
QCLQTRDIFKTKFLSEIESDSLALRQVRAILEDLGLTLTSDDALMVLEVCQAVSRRAAQL
CGAGVAAVVEKIRENRGLQELTVSVGVDGTLYKLHPHFSRLVSVTVRKLAPQCTVTFLQS
EDGSGKGAALVTRVACRLTQMACV
NT seq 2775 nt   +upstreamnt  +downstreamnt
atggccgccattgagccttctggtctgcacccgggagaaagagactcaagctgcccccag
gagggcattccaaggccctcaggtagcttagaactggcacaggaatacttgcaacaattc
aaggtgaccatgacacagctgcagcagatccaagccagtcttctgtgttccatggagcag
gcgctgaagggacaggacagtcccgctccttctgtccggatgttgcccacatacgtgagg
tccacaccacatggcaccgagcaaggagacttcctggtgctggagctgggggccacagga
gcctcactacgtgtgttgtgggtaacactgacgggcaccaaggaacacagcgtggagacc
aggagccaggagtttgtgatccctcaagaggtgatcctaggtgctggccagcagctcttt
gactttgctgcccgctgcctctctgaattcctggatgcataccccgtggagaatcagggt
ctgaagcttgggtttaatttctcttttccttgtcaccagacaggcttggacaagagcacc
ctcatttcctggacaaaaggttttaggtgcagtggtgtggaaggccaggatgtggtccag
ttgctaagggatgccattcagaggcaggggacctacaatattgatgtggtagccatggtg
aatgacacagtgggtaccatgatgggctgtgagctgggcaccaggccatgtgaagtcggg
cttattgtagacactggtaccaatgcctgttatatggaggaagcgaggcacgtggcagct
ctggatgaggaccgcggccgtacctgtgtcagcatcgagtggggctccttctatgacgaa
gaggccctagggccagtactgaccaccttcgacgatgccctggaccacgagtccctggtt
cctggtgctcagaggtttgagaagatgattggtggcctttacttgggtgagctggtaagg
ctggtgctggtccacttgtcccagcatggggtcctctttggtggctgcgcctctcctgcg
ttgctgagtcaaaacagcatcctcctggaacatgtggccaaaatggaggaccctgccact
gggatagcccacgtccacacagtcctgcagggcttgggtctgagccctcaggcctcagat
gctgagctcgtgcagcgcgtgtgcatggctgtgtgcacgcgagctgcccagctctgtgcc
tctgccctggctgcagtcctatcccgcctccagcacagcagggagcagcagacactgcac
gtggccgtggccactggagggcgagtgttcgaatggcaccccaggttcctctgcatccta
aaggagacggtaatgctcttggccccagagtgtgatgtctccttcatcccctctgtggat
ggtggtggccggggtgtggcaatggtgactgctgtggcagcccgcctggctacccacagg
cgcatcctggaagagaccctggcaccatttcagctgagcttggagcagctgacagcggtg
caggcacaaatgcgggaagccatgatcagggggcttcaaggagagagctcctccctccgc
atgctgcccacttacgtccgagcaacgcccgatggcagcgaacgaggtgacttcctggct
ttggacctagggggcaccaacttccgtgtcctgttggtacgcgtggccgagggcagtgtt
cagatcaccaaccaggtctactctattcctgagtatgtagcccagggctctggacagaag
ctctttgatcatattgtggactgcatcgtggacttccagaagaggcaaggccttagcgga
cagagcctacccctgggtttcaccttctcttttccttgcaagcagcttggcctggaccag
ggcatcctcctcaactggactaaggggttcaatgcatcaggctgcgagggccaagatgtt
gtgtatttattacgggaagccattaggcgcagacaggcagtggagctgaatgtggttgcc
attgtcaatgacacggtggggaccatgatgtcctgtggctatgatgatccctgttgtgag
atgggcctcattgtcggaaccggtaccaacgcctgctatatggaagaactccggaatgtg
gcgagtgtgcccggggactcaggccacatgtgtatcaacatggagtggggtgcctttggg
gatgacggctcactgagcatgctcggcacctgctttgatgctagcgtggaccaggcatcc
atcaacccaggcaaacagaggtttgagaaaatgatcagcggaatgtacctgggggagatc
gtccgccatatcctcctgcacttaaccagtcttggagttctcttccggggccagaagacg
caatgccttcagaccagggacatctttaagaccaagtttctctccgagattgagagcgac
agcctggccctgcgtcaggtccgagccatcctggaggacctggggctgactctgacgtct
gatgatgccttgatggtcctagaggtgtgccaggctgtgtcccgcagggccgcccaactc
tgcggggcaggtgtggctgcagtggtggaaaagatacgggagaaccggggcctgcaggag
ctgacagtgtctgtgggagtggatgggacgctctacaagctacatccccacttctccagg
ctggtgtcagtgacagttcggaagctagcccctcagtgcacagtcacctttttgcaatcg
gaggatgggtctgggaaaggggcagcgttggtcactcgtgtcgcttgccgcctgacccag
atggcctgcgtttga

DBGET integrated database retrieval system