KEGG   Rattus norvegicus (rat): 100912314
Entry
100912314         CDS       T01003                                 
Name
(RefSeq) interferon alpha-1-like
  KO
K05414  interferon alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04151  PI3K-Akt signaling pathway
rno04217  Necroptosis
rno04620  Toll-like receptor signaling pathway
rno04621  NOD-like receptor signaling pathway
rno04622  RIG-I-like receptor signaling pathway
rno04623  Cytosolic DNA-sensing pathway
rno04630  JAK-STAT signaling pathway
rno04650  Natural killer cell mediated cytotoxicity
rno04936  Alcoholic liver disease
rno05152  Tuberculosis
rno05160  Hepatitis C
rno05161  Hepatitis B
rno05162  Measles
rno05163  Human cytomegalovirus infection
rno05164  Influenza A
rno05165  Human papillomavirus infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05171  Coronavirus disease - COVID-19
rno05200  Pathways in cancer
rno05320  Autoimmune thyroid disease
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100912314
   04151 PI3K-Akt signaling pathway
    100912314
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100912314
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100912314
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100912314
   04621 NOD-like receptor signaling pathway
    100912314
   04622 RIG-I-like receptor signaling pathway
    100912314
   04623 Cytosolic DNA-sensing pathway
    100912314
   04650 Natural killer cell mediated cytotoxicity
    100912314
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100912314
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100912314
   05161 Hepatitis B
    100912314
   05160 Hepatitis C
    100912314
   05171 Coronavirus disease - COVID-19
    100912314
   05164 Influenza A
    100912314
   05162 Measles
    100912314
   05168 Herpes simplex virus 1 infection
    100912314
   05163 Human cytomegalovirus infection
    100912314
   05167 Kaposi sarcoma-associated herpesvirus infection
    100912314
   05169 Epstein-Barr virus infection
    100912314
   05165 Human papillomavirus infection
    100912314
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100912314
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100912314
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100912314
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    100912314
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    100912314
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Interferons
   100912314
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 100912314
NCBI-ProteinID: XP_038967026
RGD: 6487699
Ensembl: ENSRNOG00000056992
LinkDB
Position
5:complement(103285510..103288640)
AA seq 191 aa
MARLCAFLMILIVMSYCRSTCCLGCDLPHTHNLRNKRAFTLLAQMRRLSPVSCLKDRQDF
GFPLEKVDGQQIQKAQAIPVLHELTQQILSLFTSKESSTAWDATLLDSFCNDLQQQLSGL
QACQMQQVGVQESHLAQEDSLLAVREYFHRITVYLREKKHSPCAWEVVRAEVWRALSSSA
NLLARLREEKK
NT seq 576 nt   +upstreamnt  +downstreamnt
atggctaggctttgtgctttcctgatgatcctgatcgtgatgagctattgtagatcaacc
tgctgtctaggatgtgacctgcctcatactcataacctcaggaacaagagagcattcaca
ctcctggcacaaatgaggagactctcccctgtctcctgcctgaaggacagacaggacttt
ggattccccttggagaaggtggatggccagcagatccagaaggctcaagctatccctgtc
ctgcatgagctgacccagcagatcctcagcctcttcacatcaaaggagtcatctactgct
tgggatgcaaccctcctagactcattctgcaatgacctccagcagcagctgagtggtctg
caagcctgtcagatgcagcaagtgggggtgcaggaatctcacctggcccaggaagactcc
ctattggctgtgcgggaatacttccacaggatcactgtgtacctgagagagaagaaacac
agcccctgtgcctgggaggtggtcagagcagaagtctggagagctctgtcttcttcagcc
aacttgctggcaagactaagagaagagaagaaatga

KEGG   Rattus norvegicus (rat): 24481
Entry
24481             CDS       T01003                                 
Symbol
Ifnb1
Name
(RefSeq) interferon beta precursor
  KO
K05415  interferon beta
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04151  PI3K-Akt signaling pathway
rno04217  Necroptosis
rno04380  Osteoclast differentiation
rno04620  Toll-like receptor signaling pathway
rno04621  NOD-like receptor signaling pathway
rno04622  RIG-I-like receptor signaling pathway
rno04623  Cytosolic DNA-sensing pathway
rno04630  JAK-STAT signaling pathway
rno04650  Natural killer cell mediated cytotoxicity
rno04668  TNF signaling pathway
rno04936  Alcoholic liver disease
rno05135  Yersinia infection
rno05142  Chagas disease
rno05152  Tuberculosis
rno05160  Hepatitis C
rno05161  Hepatitis B
rno05162  Measles
rno05163  Human cytomegalovirus infection
rno05164  Influenza A
rno05165  Human papillomavirus infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05171  Coronavirus disease - COVID-19
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    24481 (Ifnb1)
   04668 TNF signaling pathway
    24481 (Ifnb1)
   04151 PI3K-Akt signaling pathway
    24481 (Ifnb1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    24481 (Ifnb1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    24481 (Ifnb1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    24481 (Ifnb1)
   04621 NOD-like receptor signaling pathway
    24481 (Ifnb1)
   04622 RIG-I-like receptor signaling pathway
    24481 (Ifnb1)
   04623 Cytosolic DNA-sensing pathway
    24481 (Ifnb1)
   04650 Natural killer cell mediated cytotoxicity
    24481 (Ifnb1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    24481 (Ifnb1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    24481 (Ifnb1)
   05161 Hepatitis B
    24481 (Ifnb1)
   05160 Hepatitis C
    24481 (Ifnb1)
   05171 Coronavirus disease - COVID-19
    24481 (Ifnb1)
   05164 Influenza A
    24481 (Ifnb1)
   05162 Measles
    24481 (Ifnb1)
   05168 Herpes simplex virus 1 infection
    24481 (Ifnb1)
   05163 Human cytomegalovirus infection
    24481 (Ifnb1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    24481 (Ifnb1)
   05169 Epstein-Barr virus infection
    24481 (Ifnb1)
   05165 Human papillomavirus infection
    24481 (Ifnb1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    24481 (Ifnb1)
   05152 Tuberculosis
    24481 (Ifnb1)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    24481 (Ifnb1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    24481 (Ifnb1)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    24481 (Ifnb1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    24481 (Ifnb1)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Interferons
   24481 (Ifnb1)
SSDB
Motif
Pfam: Interferon YWFCY
Other DBs
NCBI-GeneID: 24481
NCBI-ProteinID: NP_062000
RGD: 2865
Ensembl: ENSRNOG00000006268
UniProt: P70499 A0A7R8GV74
LinkDB
Position
5:complement(103020969..103021523)
AA seq 184 aa
MANRWTLHIAFLLCFSTTALSIDYKQLQFRQSTSIRTCQKLLRQLNGRLNLSYRTDFKIP
MEVMHPSQMEKSYTAFAIQVMLQNVFLVFRSNFSSTGWNETIVESLLDELHQQTELLEII
LKEKQEERLTWVTSTTTLGLKSYYWRVQRYLKDKKYNSYAWMVVRAEVFRNFSIILRLNR
NFQN
NT seq 555 nt   +upstreamnt  +downstreamnt
atggccaacaggtggaccctccacattgcgttcctgctgtgcttctccaccactgccctc
tccatcgactacaagcagctccagttccgacaaagcactagcattcggacatgtcagaag
ctcctgaggcagctgaatggaaggctcaacctcagctacaggacggacttcaagatccct
atggaggtgatgcacccgtcacagatggagaagagttacactgcctttgccattcaagtg
atgctccagaatgtctttcttgtcttcagaagcaatttctccagcactgggtggaatgag
actattgttgaaagtctcttggatgaactacatcagcagacagagcttctggagataata
ctaaaggaaaagcaagaggaaagattgacttgggtgacatccacgactactttaggcttg
aagagctattactggagggtacaaaggtaccttaaagacaagaagtacaacagctatgcc
tggatggtggtccgagcagaagtcttcaggaacttttccattattctaagacttaataga
aacttccagaactga

KEGG   Rattus norvegicus (rat): 298205
Entry
298205            CDS       T01003                                 
Symbol
Ifna4
Name
(RefSeq) interferon, alpha 4 precursor
  KO
K05414  interferon alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04151  PI3K-Akt signaling pathway
rno04217  Necroptosis
rno04620  Toll-like receptor signaling pathway
rno04621  NOD-like receptor signaling pathway
rno04622  RIG-I-like receptor signaling pathway
rno04623  Cytosolic DNA-sensing pathway
rno04630  JAK-STAT signaling pathway
rno04650  Natural killer cell mediated cytotoxicity
rno04936  Alcoholic liver disease
rno05152  Tuberculosis
rno05160  Hepatitis C
rno05161  Hepatitis B
rno05162  Measles
rno05163  Human cytomegalovirus infection
rno05164  Influenza A
rno05165  Human papillomavirus infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05171  Coronavirus disease - COVID-19
rno05200  Pathways in cancer
rno05320  Autoimmune thyroid disease
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    298205 (Ifna4)
   04151 PI3K-Akt signaling pathway
    298205 (Ifna4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    298205 (Ifna4)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    298205 (Ifna4)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    298205 (Ifna4)
   04621 NOD-like receptor signaling pathway
    298205 (Ifna4)
   04622 RIG-I-like receptor signaling pathway
    298205 (Ifna4)
   04623 Cytosolic DNA-sensing pathway
    298205 (Ifna4)
   04650 Natural killer cell mediated cytotoxicity
    298205 (Ifna4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    298205 (Ifna4)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    298205 (Ifna4)
   05161 Hepatitis B
    298205 (Ifna4)
   05160 Hepatitis C
    298205 (Ifna4)
   05171 Coronavirus disease - COVID-19
    298205 (Ifna4)
   05164 Influenza A
    298205 (Ifna4)
   05162 Measles
    298205 (Ifna4)
   05168 Herpes simplex virus 1 infection
    298205 (Ifna4)
   05163 Human cytomegalovirus infection
    298205 (Ifna4)
   05167 Kaposi sarcoma-associated herpesvirus infection
    298205 (Ifna4)
   05169 Epstein-Barr virus infection
    298205 (Ifna4)
   05165 Human papillomavirus infection
    298205 (Ifna4)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    298205 (Ifna4)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    298205 (Ifna4)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    298205 (Ifna4)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    298205 (Ifna4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    298205 (Ifna4)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Interferons
   298205 (Ifna4)
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 298205
NCBI-ProteinID: NP_001100137
RGD: 1306334
Ensembl: ENSRNOG00000033823
UniProt: D3ZFH0
LinkDB
Position
5:complement(103069483..103070052)
AA seq 189 aa
MARLCAFLMVLVVMSYWSACCLGCDLPPTLNLRNKRAFTLLAQMRRLSPVSCLKDRQDFG
FPQEKVDAQQIQKAQTIPVLHELSQQVLNIFTSKDSSAAWNATLLDSFCNDLHQQLSDLK
VCLMQQVGMQEPPLTQEDSLLAVREYFHRITVYLTEKKHSPCAWEVVRAEVWRALSSSVY
LLAKLSEEK
NT seq 570 nt   +upstreamnt  +downstreamnt
atggctaggctctgtgctttcctgatggttctggtggtgatgagctactggtcagcctgc
tgtctaggatgtgacctgcctcccactctcaatctcaggaacaagagagccttcacactc
ctggcacaaatgaggagactctcccctgtctcctgcctgaaggacagacaggactttgga
ttcccccaggagaaggtggatgcccagcagatccagaaggctcaaaccatccctgttctg
catgagctgtcccagcaggtcctgaacatcttcacatcaaaggactcatctgctgcttgg
aatgcaaccctcctagactcattctgcaatgacctccaccagcagctcagtgacctcaaa
gtctgtctgatgcagcaggttggaatgcaagaacctcccctaacccaagaagactccctg
ctggctgtgcgggaatacttccacaggatcactgtgtacctgacagagaagaaacacagc
ccctgtgcctgggaagtggtcagagcagaagtgtggagagccctgtcttcctcagtctac
ttgctagcaaaactgagtgaggagaagtga

KEGG   Rattus norvegicus (rat): 298210
Entry
298210            CDS       T01003                                 
Symbol
Ifna5
Name
(RefSeq) interferon alpha-1 precursor
  KO
K05414  interferon alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04151  PI3K-Akt signaling pathway
rno04217  Necroptosis
rno04620  Toll-like receptor signaling pathway
rno04621  NOD-like receptor signaling pathway
rno04622  RIG-I-like receptor signaling pathway
rno04623  Cytosolic DNA-sensing pathway
rno04630  JAK-STAT signaling pathway
rno04650  Natural killer cell mediated cytotoxicity
rno04936  Alcoholic liver disease
rno05152  Tuberculosis
rno05160  Hepatitis C
rno05161  Hepatitis B
rno05162  Measles
rno05163  Human cytomegalovirus infection
rno05164  Influenza A
rno05165  Human papillomavirus infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05171  Coronavirus disease - COVID-19
rno05200  Pathways in cancer
rno05320  Autoimmune thyroid disease
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    298210 (Ifna5)
   04151 PI3K-Akt signaling pathway
    298210 (Ifna5)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    298210 (Ifna5)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    298210 (Ifna5)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    298210 (Ifna5)
   04621 NOD-like receptor signaling pathway
    298210 (Ifna5)
   04622 RIG-I-like receptor signaling pathway
    298210 (Ifna5)
   04623 Cytosolic DNA-sensing pathway
    298210 (Ifna5)
   04650 Natural killer cell mediated cytotoxicity
    298210 (Ifna5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    298210 (Ifna5)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    298210 (Ifna5)
   05161 Hepatitis B
    298210 (Ifna5)
   05160 Hepatitis C
    298210 (Ifna5)
   05171 Coronavirus disease - COVID-19
    298210 (Ifna5)
   05164 Influenza A
    298210 (Ifna5)
   05162 Measles
    298210 (Ifna5)
   05168 Herpes simplex virus 1 infection
    298210 (Ifna5)
   05163 Human cytomegalovirus infection
    298210 (Ifna5)
   05167 Kaposi sarcoma-associated herpesvirus infection
    298210 (Ifna5)
   05169 Epstein-Barr virus infection
    298210 (Ifna5)
   05165 Human papillomavirus infection
    298210 (Ifna5)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    298210 (Ifna5)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    298210 (Ifna5)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    298210 (Ifna5)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    298210 (Ifna5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    298210 (Ifna5)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Interferons
   298210 (Ifna5)
SSDB
Motif
Pfam: Interferon RIX1
Other DBs
NCBI-GeneID: 298210
NCBI-ProteinID: NP_001014786
RGD: 1359312
Ensembl: ENSRNOG00000031046
UniProt: P05011
LinkDB
Position
5:complement(103187852..103188430)
AA seq 192 aa
MARLCAFLMSLVVVSYWSACCLGCDLPHTHNLRNKRVFTLLAQMRRLSPVSCLKDRKYFG
FPLEKVDGQQIQKAQAIPVLHELTQQILSLFTSKESSTAWDATLLDSFCNDLQQQLSGLQ
ACLMQQVGVQESPLTQEDSLLAVREYFHRITVYLRENKHSPCAWEVVKAEVWRALSSSAN
LMGRLREERNES
NT seq 579 nt   +upstreamnt  +downstreamnt
atggctcggctctgtgctttcttgatgtccctggtggtggtgagctactggtcagcctgc
tgtctaggatgtgacctgcctcatactcataacctcaggaacaagagagtcttcacactc
ctggcacaaatgaggagactctcccctgtctcatgcctgaaggacagaaagtactttggg
ttccctttggagaaggtggatggccagcagatccagaaggctcaagctatccctgtcctg
catgagctgacccagcagatcctcagcctcttcacatcaaaggagtcatctactgcttgg
gatgcaaccctcctagactcattctgtaatgacctccagcagcagctgagtggtctgcaa
gcctgtctgatgcagcaggtaggggtgcaggaatctcccctgacccaggaagactcccta
ctggctgtgagggaatacttccacagaatcactgtgtacctgagagagaataaacacagc
ccctgtgcctgggaggtggtcaaagcagaagtctggagagccctgtcttcctcagccaac
ttgatgggaagactgagagaagaaagaaatgagtcctga

KEGG   Rattus norvegicus (rat): 298213
Entry
298213            CDS       T01003                                 
Symbol
Ifna2
Name
(RefSeq) interferon alpha family, gene 2 precursor
  KO
K05414  interferon alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04151  PI3K-Akt signaling pathway
rno04217  Necroptosis
rno04620  Toll-like receptor signaling pathway
rno04621  NOD-like receptor signaling pathway
rno04622  RIG-I-like receptor signaling pathway
rno04623  Cytosolic DNA-sensing pathway
rno04630  JAK-STAT signaling pathway
rno04650  Natural killer cell mediated cytotoxicity
rno04936  Alcoholic liver disease
rno05152  Tuberculosis
rno05160  Hepatitis C
rno05161  Hepatitis B
rno05162  Measles
rno05163  Human cytomegalovirus infection
rno05164  Influenza A
rno05165  Human papillomavirus infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05171  Coronavirus disease - COVID-19
rno05200  Pathways in cancer
rno05320  Autoimmune thyroid disease
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    298213 (Ifna2)
   04151 PI3K-Akt signaling pathway
    298213 (Ifna2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    298213 (Ifna2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    298213 (Ifna2)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    298213 (Ifna2)
   04621 NOD-like receptor signaling pathway
    298213 (Ifna2)
   04622 RIG-I-like receptor signaling pathway
    298213 (Ifna2)
   04623 Cytosolic DNA-sensing pathway
    298213 (Ifna2)
   04650 Natural killer cell mediated cytotoxicity
    298213 (Ifna2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    298213 (Ifna2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    298213 (Ifna2)
   05161 Hepatitis B
    298213 (Ifna2)
   05160 Hepatitis C
    298213 (Ifna2)
   05171 Coronavirus disease - COVID-19
    298213 (Ifna2)
   05164 Influenza A
    298213 (Ifna2)
   05162 Measles
    298213 (Ifna2)
   05168 Herpes simplex virus 1 infection
    298213 (Ifna2)
   05163 Human cytomegalovirus infection
    298213 (Ifna2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    298213 (Ifna2)
   05169 Epstein-Barr virus infection
    298213 (Ifna2)
   05165 Human papillomavirus infection
    298213 (Ifna2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    298213 (Ifna2)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    298213 (Ifna2)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    298213 (Ifna2)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    298213 (Ifna2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    298213 (Ifna2)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Interferons
   298213 (Ifna2)
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 298213
NCBI-ProteinID: NP_001258147
RGD: 1311425
Ensembl: ENSRNOG00000058365
UniProt: A0A0G2K3I2
LinkDB
Position
5:complement(103258617..103259195)
AA seq 192 aa
MARLCAFLMSLVVMSYWSACCLGCDLPHTHNLRNKRAFTLLAQMRRLSPVSCLKDRKDFG
FPLEKVDGQQIQKAQAIPVLHELTQQILSLFTSKESSTAWDASLLDSFCNDLQQQLSGLQ
ACLMQQVGVQESPLTQEDSLLAVREYFHRITVYLREKKHSPCAWEVVRAEVWRALSSSAN
LLGRLREERNES
NT seq 579 nt   +upstreamnt  +downstreamnt
atggctcggctctgtgctttcttgatgtccctggtggtgatgagctactggtcagcctgc
tgtctaggatgtgacctgcctcacactcataacctcaggaacaagagagccttcacactc
ctggcacaaatgaggagactctcccctgtctcatgcctgaaggacagaaaggactttggg
ttccctttggagaaggtggatggccagcagatccagaaggctcaagctatccctgtcctg
catgagctgacccagcagatcctcagcctcttcacatcaaaggagtcatctactgcttgg
gatgcatccctgctagactcattctgtaatgacctccagcagcagctgagtggtctgcaa
gcctgtctgatgcagcaggtaggggtgcaggaatctcccctgacccaggaagactcccta
ctggctgtgagggaatacttccacaggatcactgtgtacctgagagagaagaaacacagc
ccctgtgcctgggaggtggtcagagcagaagtctggagagccctgtcttcctcagccaac
ttgctgggaagactgagagaagaaagaaatgagtcctga

KEGG   Rattus norvegicus (rat): 500491
Entry
500491            CDS       T01003                                 
Symbol
Ifna16l1
Name
(RefSeq) interferon alpha-1-like
  KO
K05414  interferon alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04151  PI3K-Akt signaling pathway
rno04217  Necroptosis
rno04620  Toll-like receptor signaling pathway
rno04621  NOD-like receptor signaling pathway
rno04622  RIG-I-like receptor signaling pathway
rno04623  Cytosolic DNA-sensing pathway
rno04630  JAK-STAT signaling pathway
rno04650  Natural killer cell mediated cytotoxicity
rno04936  Alcoholic liver disease
rno05152  Tuberculosis
rno05160  Hepatitis C
rno05161  Hepatitis B
rno05162  Measles
rno05163  Human cytomegalovirus infection
rno05164  Influenza A
rno05165  Human papillomavirus infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05171  Coronavirus disease - COVID-19
rno05200  Pathways in cancer
rno05320  Autoimmune thyroid disease
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    500491 (Ifna16l1)
   04151 PI3K-Akt signaling pathway
    500491 (Ifna16l1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    500491 (Ifna16l1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    500491 (Ifna16l1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    500491 (Ifna16l1)
   04621 NOD-like receptor signaling pathway
    500491 (Ifna16l1)
   04622 RIG-I-like receptor signaling pathway
    500491 (Ifna16l1)
   04623 Cytosolic DNA-sensing pathway
    500491 (Ifna16l1)
   04650 Natural killer cell mediated cytotoxicity
    500491 (Ifna16l1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    500491 (Ifna16l1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    500491 (Ifna16l1)
   05161 Hepatitis B
    500491 (Ifna16l1)
   05160 Hepatitis C
    500491 (Ifna16l1)
   05171 Coronavirus disease - COVID-19
    500491 (Ifna16l1)
   05164 Influenza A
    500491 (Ifna16l1)
   05162 Measles
    500491 (Ifna16l1)
   05168 Herpes simplex virus 1 infection
    500491 (Ifna16l1)
   05163 Human cytomegalovirus infection
    500491 (Ifna16l1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    500491 (Ifna16l1)
   05169 Epstein-Barr virus infection
    500491 (Ifna16l1)
   05165 Human papillomavirus infection
    500491 (Ifna16l1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    500491 (Ifna16l1)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    500491 (Ifna16l1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    500491 (Ifna16l1)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    500491 (Ifna16l1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    500491 (Ifna16l1)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Interferons
   500491 (Ifna16l1)
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 500491
NCBI-ProteinID: XP_575856
RGD: 1565225
Ensembl: ENSRNOG00000033602
UniProt: D4A428
LinkDB
Position
5:complement(103216368..103216984)
AA seq 191 aa
MARLCAFLMILIVMSYCRSTCCLGCDLPHTHNLRNKRAFTLLAQMRRLSPVSCLKDRQDF
GFPLEKVDGQQIQKAQAIPVLQELTQQILSLFTSKESFTAWDATLLDSFCNDLQQQLSGL
QACQMQQVGVKESHLAQEDSLLAVREYFHRITVYLREKKHSPCAWEVVRAEVWRALSSSA
NLLARLREEKK
NT seq 576 nt   +upstreamnt  +downstreamnt
atggctaggctttgtgctttcctgatgatcctgatcgtgatgagctattgtagatcaacc
tgctgtctaggatgtgacctgcctcatactcataacctcaggaacaagagagcattcaca
ctcctggcacaaatgaggagactctcccctgtctcctgcctgaaggacagacaggacttt
ggattccccttggagaaggtggatggccagcagatccagaaggctcaagctatccctgtc
ctgcaagagctaacccagcagatcctcagcctcttcacatcaaaggagtcatttactgct
tgggatgcaaccctcctagactcattctgcaatgacctccagcagcagctgagtggtctg
caagcctgtcagatgcagcaagtgggggtgaaggaatctcacctggcccaggaagactcc
ctactggctgtgcgggaatatttccataggatcactgtgtacctgagagagaagaaacac
agtccctgtgcctgggaggtggtcagagcagaagtctggagagctctgtcttcttcagcc
aacttgctggcaagactaagagaagagaagaaatga

KEGG   Rattus norvegicus (rat): 502961
Entry
502961            CDS       T01003                                 
Symbol
RGD1559679
Name
(RefSeq) interferon alpha-1-like
  KO
K05414  interferon alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04151  PI3K-Akt signaling pathway
rno04217  Necroptosis
rno04620  Toll-like receptor signaling pathway
rno04621  NOD-like receptor signaling pathway
rno04622  RIG-I-like receptor signaling pathway
rno04623  Cytosolic DNA-sensing pathway
rno04630  JAK-STAT signaling pathway
rno04650  Natural killer cell mediated cytotoxicity
rno04936  Alcoholic liver disease
rno05152  Tuberculosis
rno05160  Hepatitis C
rno05161  Hepatitis B
rno05162  Measles
rno05163  Human cytomegalovirus infection
rno05164  Influenza A
rno05165  Human papillomavirus infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05171  Coronavirus disease - COVID-19
rno05200  Pathways in cancer
rno05320  Autoimmune thyroid disease
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    502961 (RGD1559679)
   04151 PI3K-Akt signaling pathway
    502961 (RGD1559679)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    502961 (RGD1559679)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    502961 (RGD1559679)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    502961 (RGD1559679)
   04621 NOD-like receptor signaling pathway
    502961 (RGD1559679)
   04622 RIG-I-like receptor signaling pathway
    502961 (RGD1559679)
   04623 Cytosolic DNA-sensing pathway
    502961 (RGD1559679)
   04650 Natural killer cell mediated cytotoxicity
    502961 (RGD1559679)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    502961 (RGD1559679)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    502961 (RGD1559679)
   05161 Hepatitis B
    502961 (RGD1559679)
   05160 Hepatitis C
    502961 (RGD1559679)
   05171 Coronavirus disease - COVID-19
    502961 (RGD1559679)
   05164 Influenza A
    502961 (RGD1559679)
   05162 Measles
    502961 (RGD1559679)
   05168 Herpes simplex virus 1 infection
    502961 (RGD1559679)
   05163 Human cytomegalovirus infection
    502961 (RGD1559679)
   05167 Kaposi sarcoma-associated herpesvirus infection
    502961 (RGD1559679)
   05169 Epstein-Barr virus infection
    502961 (RGD1559679)
   05165 Human papillomavirus infection
    502961 (RGD1559679)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    502961 (RGD1559679)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    502961 (RGD1559679)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    502961 (RGD1559679)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    502961 (RGD1559679)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    502961 (RGD1559679)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Interferons
   502961 (RGD1559679)
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 502961
NCBI-ProteinID: XP_038967027
RGD: 1559679
LinkDB
Position
5:complement(103300554..103306107)
AA seq 189 aa
MPSLSAFLVVLVVMSHWSACCLGCDLPPTLNLRNKRAFTLLAQMRRLSPVSCLKDRKDFG
FPLEKVDAQQIQKAQAISILHELSQQVLNIYTSKDSSAAWDATLLDSFCNDLQQQLSGLQ
ACQMHQVGVQEPPLAQEDSLLAVREYFHRITVYLREKKHSSCAWEVVRAEVWRALSSSAN
LLSRLREEK
NT seq 570 nt   +upstreamnt  +downstreamnt
atgcctagtctctctgctttcctagtggtcctggtggtgatgagccactggtcagcctgc
tgtctaggatgtgacctgcctcccactctcaatctcaggaacaagagagccttcacactc
ctggcacaaatgaggagactctcccctgtctcatgcctgaaggacagaaaggactttgga
ttccctttggagaaggtggatgcccagcagatccagaaggctcaagccatctctatcctg
catgagctgtcccagcaggtcctgaatatctacacatcaaaggactcatctgctgcttgg
gatgcaaccctcctagattcattctgcaatgacctccagcagcagctgagtggtctgcaa
gcctgtcagatgcatcaagtgggggtgcaggaacctcctctggcccaggaagactccctg
ctggctgtgagggaatacttccacaggatcactgtgtacctgagagagaagaaacacagc
tcctgtgcctgggaggtggtcagagcagaagtctggagagccctgtcttcctcagccaac
ttgctgtcaagactgagagaagagaagtga

KEGG   Rattus norvegicus (rat): 690894
Entry
690894            CDS       T01003                                 
Symbol
Ifna1
Name
(RefSeq) interferon alpha-5
  KO
K05414  interferon alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04151  PI3K-Akt signaling pathway
rno04217  Necroptosis
rno04620  Toll-like receptor signaling pathway
rno04621  NOD-like receptor signaling pathway
rno04622  RIG-I-like receptor signaling pathway
rno04623  Cytosolic DNA-sensing pathway
rno04630  JAK-STAT signaling pathway
rno04650  Natural killer cell mediated cytotoxicity
rno04936  Alcoholic liver disease
rno05152  Tuberculosis
rno05160  Hepatitis C
rno05161  Hepatitis B
rno05162  Measles
rno05163  Human cytomegalovirus infection
rno05164  Influenza A
rno05165  Human papillomavirus infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05171  Coronavirus disease - COVID-19
rno05200  Pathways in cancer
rno05320  Autoimmune thyroid disease
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    690894 (Ifna1)
   04151 PI3K-Akt signaling pathway
    690894 (Ifna1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    690894 (Ifna1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    690894 (Ifna1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    690894 (Ifna1)
   04621 NOD-like receptor signaling pathway
    690894 (Ifna1)
   04622 RIG-I-like receptor signaling pathway
    690894 (Ifna1)
   04623 Cytosolic DNA-sensing pathway
    690894 (Ifna1)
   04650 Natural killer cell mediated cytotoxicity
    690894 (Ifna1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    690894 (Ifna1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    690894 (Ifna1)
   05161 Hepatitis B
    690894 (Ifna1)
   05160 Hepatitis C
    690894 (Ifna1)
   05171 Coronavirus disease - COVID-19
    690894 (Ifna1)
   05164 Influenza A
    690894 (Ifna1)
   05162 Measles
    690894 (Ifna1)
   05168 Herpes simplex virus 1 infection
    690894 (Ifna1)
   05163 Human cytomegalovirus infection
    690894 (Ifna1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    690894 (Ifna1)
   05169 Epstein-Barr virus infection
    690894 (Ifna1)
   05165 Human papillomavirus infection
    690894 (Ifna1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    690894 (Ifna1)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    690894 (Ifna1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    690894 (Ifna1)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    690894 (Ifna1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    690894 (Ifna1)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Interferons
   690894 (Ifna1)
SSDB
Motif
Pfam: Interferon APC1_C
Other DBs
NCBI-GeneID: 690894
NCBI-ProteinID: XP_001076062
RGD: 1306135
UniProt: A0A7R8C3L7
LinkDB
Position
5:103095767..103098260
AA seq 189 aa
MARPCAFLIALVVMMYWSTCSLGCALLQQQSLRNKRALTFLTQIRRFSPVSCLKDRKDFG
FPLEKMDAQQIQKTQAIPILYELTQQVLNIFTSKDSSAAWDATLLDSFCNNLHQQLNDLK
ACLMQQSGVQEPPLTQEDSLLYVKEYFHRISVYLREKKHSPCAWEVVRAEVWRALSSSAK
LLTRQSKEE
NT seq 570 nt   +upstreamnt  +downstreamnt
atggctaggccctgtgctttcctgattgccctggtggtgatgatgtactggtcaacctgc
tctctaggatgtgccctgcttcagcaacaaagcctcaggaacaagagagccttaacattc
ctgactcaaataaggagattttcccctgtctcttgcttgaaagacagaaaggactttgga
ttccctttggagaagatggatgcccagcagatccagaagactcaagcgatccctattcta
tatgagctgacccagcaggtcctgaacatcttcacatcaaaggactcatctgctgcttgg
gatgcaaccctccttgactcattctgcaataatctccaccagcagctcaatgacctcaaa
gcctgtttgatgcagcagagtggggtgcaggaacctcccttgactcaggaagactccctg
ctgtatgtgaaggaatacttccacaggatctctgtgtacctgagagagaagaaacacagc
ccctgtgcctgggaggtggtcagagcagaagtctggagagccctgtcttcctcagccaaa
ttgctgacaagacagagtaaggaggagtga

DBGET integrated database retrieval system