KEGG   Rattus norvegicus (rat): 113927
Entry
113927            CDS       T01003                                 
Symbol
Csnk1a1
Name
(RefSeq) casein kinase I isoform alpha
  KO
K08957  casein kinase 1, alpha [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04310  Wnt signaling pathway
rno04340  Hedgehog signaling pathway
rno05010  Alzheimer disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05165  Human papillomavirus infection
rno05224  Breast cancer
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    113927 (Csnk1a1)
   04340 Hedgehog signaling pathway
    113927 (Csnk1a1)
 09160 Human Diseases
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    113927 (Csnk1a1)
   05226 Gastric cancer
    113927 (Csnk1a1)
   05224 Breast cancer
    113927 (Csnk1a1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    113927 (Csnk1a1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    113927 (Csnk1a1)
   05022 Pathways of neurodegeneration - multiple diseases
    113927 (Csnk1a1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    113927 (Csnk1a1)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     113927 (Csnk1a1)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   113927 (Csnk1a1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal ABC1 Pox_ser-thr_kin APH Kdo
Other DBs
NCBI-GeneID: 113927
NCBI-ProteinID: NP_446067
RGD: 71098
Ensembl: ENSRNOG00000017106
UniProt: P97633 A0JPL2
LinkDB
Position
18:55017049..55050184
AA seq 337 aa
MASSSGSKAEFIVGGKYKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYE
SKLYKILQGGVGIPHIRWYGQEKDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQM
ISRIEYVHTKNFIHRDIKPDNFLMGIGRHCNKLFLIDFGLAKKYRDNRTRQHIPYREDKN
LTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRTSLPWQGLKAATKKQKYEKISEKK
MSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLFRILFRTLNHQYDYTFDWTM
LKQKAAQQAASSSGQGQQAQTPTGKQTDKTKSNMKGF
NT seq 1014 nt   +upstreamnt  +downstreamnt
atggcgagcagcagcggctccaaggccgaatttatcgtcggtgggaaatacaaactggtg
cggaagatcggatctggttccttcggggacatttatctagcgatcaacatcaccaatggc
gaggaagtggcagtgaaactagaatcccagaaggccaggcatccccagttgctgtacgag
agcaaactgtataagattcttcaaggtggggttggcatccctcacatacggtggtatggg
caagaaaaagactataatgtgctagtcatggatcttctgggacccagcctcgaagacctc
ttcaatttctgttcaagaaggttcactatgaagactgtacttatgttagctgaccagatg
atcagtagaattgaatatgtgcatacaaagaattttatacacagagacattaaaccagat
aacttcctaatgggtattgggcgtcactgtaataagttattccttattgattttggtttg
gccaaaaagtacagagacaacaggacaaggcaacacataccatacagggaagataaaaac
ctcactggcactgcccggtatgccagcatcaatgcacatcttggcattgagcagagtcgc
cgagatgacatggaatctttaggatatgttttgatgtattttaatagaaccagtctgcca
tggcaagggctaaaggctgcaacaaagaaacaaaaatatgaaaagattagtgaaaagaag
atgtccactcctgttgaagttttgtgtaaggggtttcctgcagaatttgccatgtactta
aattactgtcgtgggctgcgctttgaggaagctccggattacatgtatctgaggcagctg
ttccgcatcctcttcaggaccctgaaccaccagtatgactacacgtttgattggacgatg
ttaaagcagaaagcagcccagcaggcagcctcttccagtgggcagggtcagcaggcccaa
acccccacaggcaagcaaactgacaaaaccaagagtaacatgaaaggtttctaa

DBGET integrated database retrieval system