KEGG   Rattus norvegicus (rat): 114105
Entry
114105            CDS       T01003                                 
Symbol
Cxcl2
Name
(RefSeq) C-X-C motif chemokine 2 precursor
  KO
K05505  C-X-C motif chemokine 1/2/3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04062  Chemokine signaling pathway
rno04064  NF-kappa B signaling pathway
rno04621  NOD-like receptor signaling pathway
rno04657  IL-17 signaling pathway
rno04668  TNF signaling pathway
rno04936  Alcoholic liver disease
rno05134  Legionellosis
rno05146  Amoebiasis
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05323  Rheumatoid arthritis
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    114105 (Cxcl2)
   04668 TNF signaling pathway
    114105 (Cxcl2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    114105 (Cxcl2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    114105 (Cxcl2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    114105 (Cxcl2)
   04657 IL-17 signaling pathway
    114105 (Cxcl2)
   04062 Chemokine signaling pathway
    114105 (Cxcl2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    114105 (Cxcl2)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    114105 (Cxcl2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    114105 (Cxcl2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    114105 (Cxcl2)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    114105 (Cxcl2)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    114105 (Cxcl2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    114105 (Cxcl2)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Chemokines
   114105 (Cxcl2)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 114105
NCBI-ProteinID: NP_446099
RGD: 70069
Ensembl: ENSRNOG00000002792
UniProt: P30348
LinkDB
Position
14:complement(17181030..17183075)
AA seq 100 aa
MAPPTRQLLNAVLVLLLLLATNHQGTGVVVASELRCQCLTTLPRVDFKNIQSLTVTPPGP
HCAQTEVIATLKDGHEVCLNPEAPLVQRIVQKILNKGKAN
NT seq 303 nt   +upstreamnt  +downstreamnt
atggcccctcccactcgccagctcctcaatgctgtactggtcctgctcctcctgctggcc
accaaccatcagggtacaggggttgttgtggccagtgagctgcgctgtcaatgcctgacg
accctaccaagggttgacttcaagaacatccagagcttgacggtgacccctccaggaccc
cactgcgcccagacagaagtcatagccactcttaaggatggtcatgaagtttgtctcaac
cctgaagcccccttggttcagaggatcgtccaaaagatactgaacaaaggcaaggctaac
tga

KEGG   Rattus norvegicus (rat): 171551
Entry
171551            CDS       T01003                                 
Symbol
Cxcl3
Name
(RefSeq) C-X-C motif chemokine 3 precursor
  KO
K05505  C-X-C motif chemokine 1/2/3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04062  Chemokine signaling pathway
rno04064  NF-kappa B signaling pathway
rno04621  NOD-like receptor signaling pathway
rno04657  IL-17 signaling pathway
rno04668  TNF signaling pathway
rno04936  Alcoholic liver disease
rno05134  Legionellosis
rno05146  Amoebiasis
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05323  Rheumatoid arthritis
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    171551 (Cxcl3)
   04668 TNF signaling pathway
    171551 (Cxcl3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    171551 (Cxcl3)
   04061 Viral protein interaction with cytokine and cytokine receptor
    171551 (Cxcl3)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    171551 (Cxcl3)
   04657 IL-17 signaling pathway
    171551 (Cxcl3)
   04062 Chemokine signaling pathway
    171551 (Cxcl3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    171551 (Cxcl3)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    171551 (Cxcl3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    171551 (Cxcl3)
  09163 Immune disease
   05323 Rheumatoid arthritis
    171551 (Cxcl3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    171551 (Cxcl3)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    171551 (Cxcl3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    171551 (Cxcl3)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Chemokines
   171551 (Cxcl3)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 171551
NCBI-ProteinID: NP_612531
RGD: 621812
Ensembl: ENSRNOG00000028043
UniProt: Q10746
LinkDB
Position
14:complement(17270146..17289458)
AA seq 100 aa
MAPPTRRLLNAALLLLLLLMATSHQPSGTVVARELRCQCLKTLPRVDFENIQSLTVTPPG
PHCTQTEVIATLKDGQEVCLNPQAPRLQKIIQKLLKSPSL
NT seq 303 nt   +upstreamnt  +downstreamnt
atggcccctcccacccgccggctcctcaatgctgcactgcttctgctgcttctgctgatg
gccaccagccaccagccttcagggactgttgtggcccgtgagctgcgctgtcagtgcctg
aagaccctaccaagggttgattttgagaacatccagagcttgacggtgacccctccagga
ccgcactgcacccagacagaagtcatagccactctcaaggatggtcaagaagtttgtctc
aaccctcaagctcccaggcttcagaaaatcatccagaagttactgaagagcccctccctg
tga

KEGG   Rattus norvegicus (rat): 81503
Entry
81503             CDS       T01003                                 
Symbol
Cxcl1
Name
(RefSeq) growth-regulated alpha protein precursor
  KO
K05505  C-X-C motif chemokine 1/2/3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04062  Chemokine signaling pathway
rno04064  NF-kappa B signaling pathway
rno04621  NOD-like receptor signaling pathway
rno04657  IL-17 signaling pathway
rno04668  TNF signaling pathway
rno04936  Alcoholic liver disease
rno05134  Legionellosis
rno05146  Amoebiasis
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05323  Rheumatoid arthritis
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    81503 (Cxcl1)
   04668 TNF signaling pathway
    81503 (Cxcl1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    81503 (Cxcl1)
   04061 Viral protein interaction with cytokine and cytokine receptor
    81503 (Cxcl1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    81503 (Cxcl1)
   04657 IL-17 signaling pathway
    81503 (Cxcl1)
   04062 Chemokine signaling pathway
    81503 (Cxcl1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    81503 (Cxcl1)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    81503 (Cxcl1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    81503 (Cxcl1)
  09163 Immune disease
   05323 Rheumatoid arthritis
    81503 (Cxcl1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    81503 (Cxcl1)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    81503 (Cxcl1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    81503 (Cxcl1)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Chemokines
   81503 (Cxcl1)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 81503
NCBI-ProteinID: NP_110472
RGD: 619869
Ensembl: ENSRNOG00000002802
UniProt: P14095
LinkDB
Position
14:complement(17193364..17195143)
AA seq 96 aa
MVSATRSLLCAALLLLATSRQATGAPVANELRCQCLQTVAGIHFKNIQSLKVMPPGPHCT
QTEVIATLKNGREACLDPEAPMVQKIVQKMLKGVPK
NT seq 291 nt   +upstreamnt  +downstreamnt
atggtctcagccacccgctcgcttctctgtgcagcgctgctgctgctggccaccagccgc
caagccacaggggcgcccgtcgccaatgagctgcgctgtcagtgcctgcagacagtggca
gggattcacttcaagaacatccagagtttgaaggtgatgccgccaggaccccactgcacc
caaaccgaagtcatagccacactcaagaatggtcgcgaggcttgccttgaccctgaagcc
cccatggttcagaagattgtccaaaagatgctaaagggtgtccccaagtaa

DBGET integrated database retrieval system