KEGG   Rattus norvegicus (rat): 114508
Entry
114508            CDS       T01003                                 

Gene name
Fbp2
Definition
(RefSeq) fructose-1,6-bisphosphatase isozyme 2
  KO
K03841  fructose-1,6-bisphosphatase I [EC:3.1.3.11]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00010  Glycolysis / Gluconeogenesis
rno00030  Pentose phosphate pathway
rno00051  Fructose and mannose metabolism
rno01100  Metabolic pathways
rno01200  Carbon metabolism
rno04152  AMPK signaling pathway
rno04910  Insulin signaling pathway
rno04922  Glucagon signaling pathway
Module
rno_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    114508 (Fbp2)
   00030 Pentose phosphate pathway
    114508 (Fbp2)
   00051 Fructose and mannose metabolism
    114508 (Fbp2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    114508 (Fbp2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    114508 (Fbp2)
   04922 Glucagon signaling pathway
    114508 (Fbp2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    114508 (Fbp2)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     114508 (Fbp2)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   114508 (Fbp2)
SSDB
Motif
Pfam: FBPase FBPase_C Inositol_P ACT_7 ABC2_membrane
Other DBs
NCBI-GeneID: 114508
NCBI-ProteinID: NP_446168
RGD: 620930
Ensembl: ENSRNOG00000017637
UniProt: Q9Z1N1
LinkDB
Position
17
AA seq 339 aa
MTDRSPFETDMLTLTRYVMEKGRQAKGTGELTQLLNSMLTAIKAISSAVRKAGLANLYGI
AGSVNVTGDEVKKLDVLSNSLVINMLQSSYSTCVLVSEENKEAVITAKERRGKYVVCFDP
LDGSSNIDCLASIGTIFAIYRKTTEDEPSEKDALQPGRNIVAAGYALYGSATLVALSTGQ
GVDLFMLDPALGEFVLVEKDIRIKKKGKIFSLNEGYAKYFDAATAEYVQKKKFPEDGSAP
YGARYVGSMVADVHRTLVYGGIFMYPANQKSPNGKLRLLYECNPVAYIIEQAGGMATTGT
QPVLDVKPESIHQRVPLILGSPEDVQEYLSCVQRNQAGR
NT seq 1020 nt   +upstreamnt  +downstreamnt
atgacggacagaagcccctttgagacagacatgctgaccctgacccgttacgttatggaa
aaggggcgacaggccaaagggaccggagaactcacccagctgctcaactcgatgctgact
gccatcaaagccatctcttccgctgtgcgaaaggccggcctggccaacctgtatgggatt
gcgggaagcgtgaatgtgacaggggatgaggtgaagaaactggatgtgctgtccaattcc
ctggtgatcaacatgcttcagtcctcctacagcacctgtgtgcttgtctcagaagagaat
aaagaggctgtgatcacagccaaggagaggagggggaaatatgtggtttgctttgaccca
ctggatggatcttcaaacattgactgcctggcttccattggaactatatttgctatctac
agaaagaccacagaggatgagccttccgagaaggatgccttgcagcctggacgcaatatc
gtggctgcaggttatgcactgtatggtagtgcaaccctggtggctctttctacagggcaa
ggagtggatctcttcatgctggacccggctcttggagaattcgtgctagtggaaaaagat
atccggattaagaagaaagggaaaatttttagcctcaatgagggctatgccaagtatttt
gatgctgctaccgctgagtatgtacagaaaaagaagttccctgaggatggcagtgcacct
tacggggcaaggtacgtgggttccatggtggctgatgtgcatcgcaccctggtctatgga
ggaatcttcatgtacccagccaaccagaagagtcctaatggcaagctccggctcctgtat
gaatgcaatcctgtagcctatatcattgagcaggcaggaggcatggcaaccacaggcacc
cagccggtactggatgtaaagcctgagagcattcaccagcgagtccccctcattctgggg
tccccggaagatgtgcaagaatatctcagctgtgtgcaaagaaaccaggcaggcaggtag

KEGG   Rattus norvegicus (rat): 24362
Entry
24362             CDS       T01003                                 

Gene name
Fbp1
Definition
(RefSeq) fructose-1,6-bisphosphatase 1
  KO
K03841  fructose-1,6-bisphosphatase I [EC:3.1.3.11]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00010  Glycolysis / Gluconeogenesis
rno00030  Pentose phosphate pathway
rno00051  Fructose and mannose metabolism
rno01100  Metabolic pathways
rno01200  Carbon metabolism
rno04152  AMPK signaling pathway
rno04910  Insulin signaling pathway
rno04922  Glucagon signaling pathway
Module
rno_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    24362 (Fbp1)
   00030 Pentose phosphate pathway
    24362 (Fbp1)
   00051 Fructose and mannose metabolism
    24362 (Fbp1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    24362 (Fbp1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    24362 (Fbp1)
   04922 Glucagon signaling pathway
    24362 (Fbp1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    24362 (Fbp1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     24362 (Fbp1)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   24362 (Fbp1)
SSDB
Motif
Pfam: FBPase FBPase_C Inositol_P
Other DBs
NCBI-GeneID: 24362
NCBI-ProteinID: NP_036690
RGD: 2595
Ensembl: ENSRNOG00000017597
UniProt: P19112
LinkDB
Position
17
AA seq 363 aa
MVDHAPFETDISTLTRFVLEEGRKAGGTGEMTQLLNSLCTAIKAISSAVRQAGIAQLYGI
AGSTNVTGDQVKKLDILSNDLVINMLKSSYATCVLVSEEDTHAIIIEPEKRGKYVVCFDP
LDGSSNIDCLASIGTIFGIYRKTSANEPSEKDALQPGRNLVAAGYALYGSATMLVLAMNC
GVNCFMLDPSIGEFILVDRDVKIKKKGNIYSINEGYAKDFDPAINEYIQRKKFPPDNSAP
YGARYVGSMVADVHRTLVYGGIFLYPANKKNPSGKLRLLYECNPIAYVMEKAGGLATTGN
EDILDIVPTEIHQKAPVIMGSTEDVQEFLEIYNKDKAKSRPSLPLPQSRARESPVHSICD
ELF
NT seq 1092 nt   +upstreamnt  +downstreamnt
atggtggaccatgcgcccttcgaaacggatatcagcaccctgacccgcttcgtcctggag
gagggcaggaaggctgggggcacgggcgagatgacccagctgctgaattcgctctgcacc
gcgatcaaagccatctcgtcagcggtgcgccaggccggcatcgctcagctctatggcatc
gctggctcaaccaatgtgactggggatcaagtgaagaagctggacatactttccaatgac
ctggtgatcaatatgctgaagtcgtcctatgctacctgtgtccttgtgtcggaagaagat
acacacgccatcataatagagcccgagaagaggggcaaatatgttgtctgttttgatccc
ctcgatggctcatccaacatcgactgcctcgcgtccatcggaaccatctttggcatttac
agaaagacatctgctaatgagccttcggagaaagatgctctgcagccaggcaggaacctg
gtggcagcaggctatgcactctatggcagcgccaccatgttggtcctggccatgaattgt
ggcgtcaactgcttcatgctggacccgtccattggagaattcattttggtggacagggat
gtgaagatcaagaagaaaggtaacatctacagcattaatgagggctatgctaaggacttt
gaccctgccatcaatgagtatatccagaggaaaaagttccctccggataattcagctccc
tatggtgcccggtatgtggggtccatggtggctgatgttcaccgcactctggtgtatgga
gggatcttcttataccctgccaacaagaaaaatccatctggaaagctgcggctgctgtac
gagtgcaatcccatcgcttacgtcatggagaaggccggtggacttgccacgacggggaat
gaagacatattagacatcgtccccactgagatccaccagaaggcaccagttatcatgggg
tccaccgaagacgtgcaggagttcctggagatctacaataaggacaaagccaaatcaagg
ccgtccctgcccctgccccagagcagagctcgagagtcaccggtccattctatctgtgac
gaacttttctag

DBGET integrated database retrieval system