KEGG   Rattus norvegicus (rat): 114597
Entry
114597            CDS       T01003                                 

Gene name
Suclg1
Definition
(RefSeq) succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial precursor
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00020  Citrate cycle (TCA cycle)
rno00640  Propanoate metabolism
rno01100  Metabolic pathways
rno01200  Carbon metabolism
Module
rno_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rno_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    114597 (Suclg1)
   00640 Propanoate metabolism
    114597 (Suclg1)
Enzymes [BR:rno01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     114597 (Suclg1)
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     114597 (Suclg1)
SSDB
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Other DBs
NCBI-GeneID: 114597
NCBI-ProteinID: NP_446204
RGD: 619821
Ensembl: ENSRNOG00000005587
UniProt: P13086
LinkDB
Position
4
AA seq 346 aa
MTAAVVAAAATATMVSGSSGLAAARLLSRTFLLQQNGIRHGSYTASRKNIYIDKNTKVIC
QGFTGKQGTFHSQQALEYGTKLVGGTTPGKGGKKHLGLPVFNTVKEAKEKTGATASVIYV
PPPFAAAAINEAIDAEIPLVVCITEGIPQQDMVRVKHKLTRQGKTRLIGPNCPGIINPGE
CKIGIMPGHIHKKGRIGIVSRSGTLTYEAVHQTTQVGLGQSLCIGIGGDPFNGTNFIDCL
DVFLKDPATEGIVLIGEIGGHAEENAAEFLKEHNSGPKAKPVVSFIAGITAPPGRRMGHA
GAIIAGGKGGAKEKISALQSAGVIVSMSPAQLGTCMYKEFEKRKML
NT seq 1041 nt   +upstreamnt  +downstreamnt
atgaccgcagcggtagttgctgcggctgccactgcaaccatggtctccggcagcagcggc
cttgccgccgcccgcctgctgtcgcgcaccttcctcctgcaacagaatggaatacggcac
gggtcttacacagcctctcggaaaaatatctatattgataaaaatacgaaggttatttgc
cagggtttcacaggcaagcagggtacctttcacagccagcaggctttggagtacggcacc
aaactcgtgggaggaaccactccagggaaagggggcaagaagcacctgggcttacctgtc
tttaatactgtgaaggaagccaaagagaaaacaggagcgacagcttctgtcatttatgtc
cctcctcctttcgctgctgccgccatcaatgaagcaattgacgcagagattcccttggtt
gtgtgcattactgaaggtattccgcagcaggacatggtgcgggtcaagcacaagctgaca
cgccaggggaagacgaggctaattgggccaaactgccccggtatcatcaaccctggagaa
tgcaaaatcggcatcatgcctggccacattcacaagaaaggaagaataggtatcgtgtcc
aggtccggtactctgacttatgaagcagttcaccaaacaacccaagttggattggggcag
tccttgtgtattggcattggaggtgacccttttaatgggactaattttattgattgcctt
gacgtcttcctgaaggatccagctacagaaggcatcgtactgattggtgaaattggtggt
cacgctgaagaaaatgctgcggagtttctgaaggagcataactcaggtccaaaggccaag
cctgtagtgtccttcattgctggtataactgctcctcctggcagaaggatgggccacgca
ggggcgattattgctggaggaaaaggtggcgccaaagagaagatctctgctcttcagagt
gcgggtgtaattgtcagcatgtcccccgcacagctgggaacctgcatgtataaggaattt
gaaaagaggaagatgctttga

KEGG   Rattus norvegicus (rat): 361071
Entry
361071            CDS       T01003                                 

Gene name
Sucla2
Definition
(RefSeq) succinyl-CoA ligase [ADP-forming] subunit beta, mitochondrial
  KO
K01900  succinyl-CoA synthetase beta subunit [EC:6.2.1.4 6.2.1.5]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00020  Citrate cycle (TCA cycle)
rno00640  Propanoate metabolism
rno01100  Metabolic pathways
rno01200  Carbon metabolism
Module
rno_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rno_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    361071 (Sucla2)
   00640 Propanoate metabolism
    361071 (Sucla2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    361071 (Sucla2)
Enzymes [BR:rno01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     361071 (Sucla2)
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     361071 (Sucla2)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   361071 (Sucla2)
SSDB
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2 DUF3947 GARS_A
Other DBs
NCBI-GeneID: 361071
NCBI-ProteinID: NP_001101857
RGD: 1309397
Ensembl: ENSRNOG00000017481
UniProt: F1LM47
LinkDB
Position
15
AA seq 465 aa
MAASMFFGRQLAAAALRSHRSQTTVRATAQALGSSGLFNKHGFQMQQQQQQQRSLSLHEY
LSMELLQEAGVSVPKGFVAKSSDEAYAIAKKLGSKDVVIKAQVLAGGRGKGTFTSGLKGG
VKIVFSPEEAKAVSSQMIGQKLITKQTGAKGRICNQVLVCERKYPRREYYFAITMERSFQ
GPVLIGSSQGGVNIEDVAAENPEAIVKEPVDIIEGVKKEQAVTLAKKMGFPSNIVDSAAE
NMIKLYNLFLKYDATMVEINPMVEDADGKVLCMDAKINFDSNSAYRQKKIFALQDWSQED
ERDKDAADADINYIGLDGNIGCLVNGAGLAMATMDIIKLHGGTPANFLDVGGGATVHQVT
EAFKLITSDKRVQAILVNIFGGIMRCDIIAQGIVMAVKDLEIRIPVVVRLQGTRVDDAKA
LIADSGLKILACDDLDEAAKMVVKLSEIVTLAKEAHVDVKFQLPI
NT seq 1398 nt   +upstreamnt  +downstreamnt
atggcggcgtccatgttcttcggccggcagttggccgcggccgccctgaggagccaccgg
tcgcagactacagtgcgagccacggcccaggctctgggaagttctggattgtttaacaag
catggattccaaatgcagcagcagcagcagcagcagaggagtctctcactgcatgaatac
ttgagtatggaattactgcaagaagcgggcgtctctgtccccaaaggcttcgttgcaaag
tcatcagatgaagcttatgcaatcgccaaaaagctagggtcaaaggatgttgtgataaag
gcacaggttttagctggcggcagaggaaaaggaacgtttacaagtggcctcaaaggagga
gtgaagattgttttctctccagaagaagcaaaagctgtttcctcacagatgattgggcaa
aaattgattaccaagcaaactggagcaaagggcagaatatgcaatcaagttttggtctgt
gagcgaaaatatcccaggagagaatactactttgcaataacaatggagaggtcatttcaa
ggccctgtactgataggaagttcacaaggtggggttaacattgaagatgttgctgctgag
aatcctgaagccattgtaaaggagcctgttgatataattgaaggcgtcaaaaaggaacaa
gctgtgacacttgcaaagaagatgggatttccttctaacattgtggactctgcagcagaa
aacatgatcaagctttataacctttttctgaagtatgacgcaactatggtagaaataaac
ccaatggtagaagatgctgatggaaaggtgttgtgcatggatgcaaagatcaattttgat
tcaaattcagcctatcgccagaagaagatctttgctcttcaggactggagccaggaggac
gagagggacaaagacgcagctgatgcagatattaactatattggcctcgacgggaacata
ggatgtctagtaaatggtgctggcttggctatggccacaatggatataataaagctacac
ggagggactccagccaacttccttgatgttggtggaggcgccacagtccatcaagtaaca
gaagcatttaaactgatcacttcagataaaagggtgcaggctattctggtcaacatcttt
ggaggaatcatgagatgtgatattattgcacaaggaatagtcatggcagtaaaagatcta
gaaattagaatacctgttgtggtacggttacaaggtacacgagttgatgatgctaaggca
ctaattgcagacagtggtcttaaaattcttgcttgcgatgatttggatgaagctgctaaa
atggttgtaaagctctctgaaatcgtgaccttagccaaagaagcccacgtggatgtgaag
tttcagttgccaatatga

KEGG   Rattus norvegicus (rat): 362404
Entry
362404            CDS       T01003                                 

Gene name
Suclg2
Definition
(RefSeq) succinyl-CoA ligase [GDP-forming] subunit beta, mitochondrial
  KO
K01900  succinyl-CoA synthetase beta subunit [EC:6.2.1.4 6.2.1.5]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00020  Citrate cycle (TCA cycle)
rno00640  Propanoate metabolism
rno01100  Metabolic pathways
rno01200  Carbon metabolism
Module
rno_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rno_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    362404 (Suclg2)
   00640 Propanoate metabolism
    362404 (Suclg2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    362404 (Suclg2)
Enzymes [BR:rno01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     362404 (Suclg2)
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     362404 (Suclg2)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   362404 (Suclg2)
SSDB
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A ATP-grasp DUF3141
Other DBs
NCBI-GeneID: 362404
NCBI-ProteinID: NP_001094220
RGD: 1305008
Ensembl: ENSRNOG00000005686
UniProt: B1H270
LinkDB
Position
4
AA seq 434 aa
MASAVAIAAQAGKLLRERSLRPRLLAVRSQAGHLTPRRWLNLQEYQSKKLMSEHGVRVQR
FFVASTAKEAQEAAKRLNAKEIVLKAQILAGGRGKGVFDSGLKGGVHLTKDPKVVGQLAQ
QMIGYNLATKQTPKEGVKVNKVMVAEALDISRETYLAILMDRSHNGPVLVGSPQGGVDIE
EVAASSPELIFKEQIDIFEGIKDSQAQRMAENLGFLGSLKNQAADQIKKLYHLFLKIDAT
QVEVNPFGETPEGQVVCFDAKINFDDNAEFRQKDIFAMDDKSENEPIENEAARYDLKYIG
LDGNIACFVNGAGLAMATCDIIFLNGGKPANFLDLGGGVKESQVYQAFKLLTSDPKVEAI
LVNIFGGIVNCAIIANGITKACQELELKVPLVVRLEGTNVQEAQNILKSSGLPITSAVDL
EDAAKKAVASVAKK
NT seq 1305 nt   +upstreamnt  +downstreamnt
atggcgtccgcggtggccatcgcggcccaggccgggaagcttctgcgagagcgatcgctg
cggccccgactcttggcggtcaggtcccaggcaggtcacttaacccccaggagatggctg
aacctgcaggaataccagagcaagaagctcatgtcagagcacggagtgagagtgcagagg
ttctttgtcgccagcactgctaaggaggctcaggaagcagccaagcgactgaatgcaaag
gaaattgttttaaaagcccagatcttagctggaggaagaggaaaaggtgtcttcgatagc
ggtttgaaaggaggtgttcatttaacaaaagaccctaaagtggtgggacagctggctcag
cagatgattggttataatctagcaacaaaacaaactccaaaagaaggtgtgaaagttaac
aaggtgatggttgctgaagccctggatatttctagagaaacgtacttggccattctgatg
gaccggtcccataatggccctgtgttagtaggcagtccccaggggggcgtcgatattgaa
gaagtggcagcttccagtccagaactcatctttaaggagcagattgacatctttgaaggg
ataaaggatagccaggcccagcgcatggcggaaaatctgggcttcctcgggtctttgaaa
aaccaggctgcagatcagattaaaaagctgtaccatctcttcctgaagattgacgccact
caggtagaagtgaaccccttcggtgaaactccagaaggccaagttgtctgttttgatgcc
aagataaactttgatgacaatgctgaattccgacaaaaggacatatttgctatggacgac
aagtcagagaatgaacccattgaaaatgaagctgccagatatgatctcaaatatataggt
ctagacgggaacatcgcctgctttgtgaatggtgctggattggccatggctacttgtgac
atcattttcctgaatggagggaagccagctaacttcttggacctcggaggtggtgtaaag
gagtcccaagtctatcaagcattcaaactgctcacatctgatcccaaggtggaagccatt
cttgtcaatatctttggtgggatcgtcaactgtgccatcattgccaacggaatcaccaaa
gcctgccaggagctagagctcaaggtgccactggtagtccgtcttgaaggaactaatgtc
caggaggctcagaacatcctcaaaagcagcggactccccattacgtcagctgtggacctg
gaggatgcagccaagaaagctgttgccagtgtggccaagaagtga

DBGET integrated database retrieval system