KEGG   Rattus norvegicus (rat): 116455
Entry
116455            CDS       T01003                                 
Symbol
Atp6v0a2
Name
(RefSeq) V-type proton ATPase 116 kDa subunit a
  KO
K02154  V-type H+-transporting ATPase subunit a
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04142  Lysosome
rno04145  Phagosome
rno04721  Synaptic vesicle cycle
rno04966  Collecting duct acid secretion
rno05152  Tuberculosis
rno05165  Human papillomavirus infection
rno05323  Rheumatoid arthritis
Module
rno_M00160  V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    116455 (Atp6v0a2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    116455 (Atp6v0a2)
   04142 Lysosome
    116455 (Atp6v0a2)
 09150 Organismal Systems
  09155 Excretory system
   04966 Collecting duct acid secretion
    116455 (Atp6v0a2)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    116455 (Atp6v0a2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    116455 (Atp6v0a2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    116455 (Atp6v0a2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    116455 (Atp6v0a2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    116455 (Atp6v0a2)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   116455 (Atp6v0a2)
SSDB
Motif
Pfam: V_ATPase_I Takusan
Other DBs
NCBI-GeneID: 116455
NCBI-ProteinID: NP_446227
RGD: 621006
Ensembl: ENSRNOG00000052704
UniProt: Q2I6B1
LinkDB
Position
12:complement(31949863..31979777)
AA seq 856 aa
MGSLFRSESMCLAQLFLQSGTAYECLSALGEKGLVQFRDLNQNVSSFQRKFVGEVKRCEE
LERILVYLVQEITRADIPLPEGEASPPAPPVKHVLEMQEQLQKLEVELREVTKNKEKLRK
NLLELVEYTHMLRVTKTFLKRNVEFEPTYEEFPALESDSLLDYSCMQRLGAKLGFVSGLI
QQGKVEAFERMLWRACKGYTIVTYAELDEALEDPETGEVIKWYVFLISFWGEQIGHKVKK
ICDCYHCHIYPYPNTAEERREIQEGLNTRIQDLYTVLHKTEDYLRQVLCKAAESVCSRVI
QVRKMKAIYHMLNMCSFDVTNKCLIAEVWCPEVDLPGLRRALEEGSRESGATIPSFMNTI
PTKETPPTLIRTNKFTEGFQNIVDAYGVGSYREVNPALFTIITFPFLFGVMFGDLGHGFV
MFLFALLLVLNENHPRLSQSQEILRMFFDGRYILLLMGLFSVYTGLIYNDCFSKSLNLFG
SGWNVSAMYSSSHSPEEQRKMVLWNDSTIRHSRTLQLDPNIPGVFRGPYPFGIDPIWNLA
TNRLTFLNSFKMKMSVILGIFHMTFGVILGIFNHLHFRKKFNIYLVSVPEILFMLCIFGY
LIFMIIYKWLAYSAETSREAPSILIEFINMFLFPSSETHGLYPGQAHVQKVLLALTVLAV
PVLFLGKPLFLLWLHNGRSCFGVSRSGYTLVRKDSEEEVSLLGSQDIEEGNNRMEEGCRE
MTCEEFNFGEILMTQAIHSIEYCLGCISNTASYLRLWALSLAHAQLSDVLWAMLMRVGLR
VDNTYGVLLLLPVMTFFAVLTVFILLVMEGLSAFLHAIRLHWVEFQNKFYVGAGTKFVPF
SFSLLSSKFSKDDSIA
NT seq 2571 nt   +upstreamnt  +downstreamnt
atgggctccctcttccgtagcgagagcatgtgcctggcgcagctcttcctgcagtcgggc
acggcctacgagtgtctgagcgcgcttggcgagaagggcctggtgcagttccgagacctc
aaccaaaatgtaagttctttccaaagaaaattcgttggtgaggtaaagaggtgtgaagaa
ctagaacgaatattggtgtacctggtgcaggaaatcaccagagctgatattcccctgcct
gagggagaggccagtcctcccgcaccacctgttaaacatgttctagaaatgcaggagcag
ctgcagaagctcgaggtggagctcagagaagtcaccaagaacaaggagaagctgaggaag
aacctgctggagctggtggagtatacccacatgctgagggtcaccaagaccttccttaaa
cggaacgtggagtttgagccaacttacgaagagttccccgccttagagagcgactctctg
ttggactacagctgcatgcagcggctgggcgccaagctgggattcgtttctggcctgatt
cagcaaggcaaagtggaagcatttgaaagaatgctgtggcgggcctgcaaagggtacacc
attgtgacctatgcagagctggacgaggccctggaagaccctgagacgggtgaagtcata
aagtggtatgtgttcctgatctcgttttggggagagcagattggccacaaggttaagaag
atctgtgactgttaccactgccacatctacccgtatccaaacacggccgaggagcgcagg
gagatccaggaggggctcaatactcggatccaagacctttacactgtgctgcacaaaacg
gaggactacctgcggcaagtgctgtgcaaggctgccgagtccgtgtgcagccgtgtgata
caggtgcggaagatgaaagccatctaccacatgctcaacatgtgcagctttgacgtcacc
aacaagtgcctcatagctgaggtctggtgccccgaggtggacctgcccggcttgcgcaga
gcgctggaggaaggctcgagagaaagtggagctacaatcccctcgttcatgaacacaatc
cctacgaaagaaacgccgcccactctgatccgcaccaacaaattcactgaaggtttccag
aacatcgtggatgcctacggtgttgggagctacagagaagtgaacccagctttgttcacc
atcatcaccttcccgttcctgtttggcgtgatgtttggtgacttggggcacggctttgtc
atgttcctgtttgccctcttactggtgttgaatgagaatcaccccagactaagccagtca
caggagatccttaggatgttctttgatggccgatatatcctgctgctgatggggctgttc
tccgtgtacaccggcctcatctacaacgactgcttctccaagtccctgaacctctttggc
tctgggtggaacgtgtctgccatgtacagttccagccactccccagaggagcaaaggaaa
atggtgctttggaatgacagcaccatcaggcacagcaggacgctgcagctggacccaaac
atccctggagttttccgaggcccctaccctttcggcatcgatcctatttggaacctggcc
acaaatcgcctcacgttcctcaactccttcaagatgaagatgtctgtgattttaggaatt
tttcacatgacctttggtgtcattctgggaatatttaaccacttgcacttcaggaagaag
ttcaacatctacctggtctcggtccccgagatcctgtttatgctctgcatctttgggtac
ctgattttcatgatcatctacaagtggctggcgtactcggcagagacctccagagaggcc
cccagcatcctcatcgagttcattaacatgttcctgttcccgtccagtgagacacacggc
ctctacccggggcaggcacacgtccagaaggtgttgttggctctcaccgtgctggctgtc
cctgtgctcttcttgggaaagccgctctttctgctgtggctgcacaatgggcgcagttgc
ttcggcgtgagccggagcggctacacgctcgtgaggaaggacagcgaggaagaggtgtct
ctcctaggcagccaggacatagaggaggggaacaaccgcatggaagagggctgccgagaa
atgacctgtgaggagtttaacttcggggagatcctgatgactcaggccatccactccatc
gagtactgccttggctgcatctccaacactgcgtcctacctgaggctttgggctctcagc
ctggcacacgcacagctctcggatgtgctgtgggccatgctgatgcgtgtaggcctgcgt
gtggacaacacttacggggtcctgctgctgctgcccgtcatgactttctttgcagttctg
accgtttttatccttctggtcatggaagggctttctgcatttctccacgccatccggctt
cactgggtagaatttcagaacaaattctacgttggtgcaggtaccaaattcgttcctttc
tccttcagtctgctgtcctccaagttcagtaaagatgacagcatagcatga

KEGG   Rattus norvegicus (rat): 116664
Entry
116664            CDS       T01003                                 
Symbol
Atp6v1f
Name
(RefSeq) V-type proton ATPase subunit F
  KO
K02151  V-type H+-transporting ATPase subunit F
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04145  Phagosome
rno04150  mTOR signaling pathway
rno04721  Synaptic vesicle cycle
rno04966  Collecting duct acid secretion
rno05165  Human papillomavirus infection
rno05323  Rheumatoid arthritis
Module
rno_M00160  V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    116664 (Atp6v1f)
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    116664 (Atp6v1f)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    116664 (Atp6v1f)
 09150 Organismal Systems
  09155 Excretory system
   04966 Collecting duct acid secretion
    116664 (Atp6v1f)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    116664 (Atp6v1f)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    116664 (Atp6v1f)
  09163 Immune disease
   05323 Rheumatoid arthritis
    116664 (Atp6v1f)
SSDB
Motif
Pfam: ATP-synt_F
Other DBs
NCBI-GeneID: 116664
NCBI-ProteinID: NP_446336
RGD: 621552
Ensembl: ENSRNOG00000007392
UniProt: P50408
Structure
LinkDB
Position
4:58067666..58070628
AA seq 119 aa
MAGRGKLIAVIGDEDTVTGFLLGGIGELNKNRHPNFLVVEKDTTINEIEDTFRQFLNRDD
IGIILINQYIAEMVRHALDAHQRSIPAVLEIPSKEHPYDAAKDSILRRAKGMFTAEDLR
NT seq 360 nt   +upstreamnt  +downstreamnt
atggcgggcaggggtaaactaatcgcagtgattggagacgaggacacggtgactggtttc
ctgttgggcggcataggggagcttaacaagaaccgccaccctaatttcctggtagtggag
aaggataccaccatcaatgaaatcgaagacactttcaggcagtttctaaacagggatgac
atcggcatcattctcatcaaccagtacatcgcagagatggttcggcacgccctcgatgcc
caccagaggtccattccagccgtcctggagatcccgtccaaggagcatccctacgacgca
gccaaagactccatcctgcgcagggccaagggcatgttcactgctgaagacctgcgctag

KEGG   Rattus norvegicus (rat): 117596
Entry
117596            CDS       T01003                                 
Symbol
Atp6v1b2
Name
(RefSeq) V-type proton ATPase subunit B, brain isoform
  KO
K02147  V-type H+-transporting ATPase subunit B
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04145  Phagosome
rno04150  mTOR signaling pathway
rno04721  Synaptic vesicle cycle
rno04966  Collecting duct acid secretion
rno05165  Human papillomavirus infection
rno05323  Rheumatoid arthritis
Module
rno_M00160  V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    117596 (Atp6v1b2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    117596 (Atp6v1b2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    117596 (Atp6v1b2)
 09150 Organismal Systems
  09155 Excretory system
   04966 Collecting duct acid secretion
    117596 (Atp6v1b2)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    117596 (Atp6v1b2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    117596 (Atp6v1b2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    117596 (Atp6v1b2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    117596 (Atp6v1b2)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   117596 (Atp6v1b2)
SSDB
Motif
Pfam: ATP-synt_ab ATP-synt_ab_N DUF2481
Other DBs
NCBI-GeneID: 117596
NCBI-ProteinID: NP_476561
RGD: 620284
Ensembl: ENSRNOG00000011891
UniProt: P62815
Structure
LinkDB
Position
16:complement(20617515..20641651)
AA seq 511 aa
MALRAMRGIVNGAAPELPVPTGGPMAGAREQALAVSRNYLSQPRLTYKTVSGVNGPLVIL
DHVKFPRYAEIVHLTLPDGTKRSGQVLEVSGSKAVVQVFEGTSGIDAKKTSCEFTGDILR
TPVSEDMLGRVFNGSGKPIDRGPVVLAEDFLDIMGQPINPQCRIYPEEMIQTGISAIDGM
NSIARGQKIPIFSAAGLPHNEIAAQICRQAGLVKKSKDVVDYSEENFAIVFAAMGVNMET
ARFFKSDFEENGSMDNVCLFLNLANDPTIERIITPRLALTTAEFLAYQCEKHVLVILTDM
SSYAEALREVSAAREEVPGRRGFPGYMYTDLATIYERAGRVEGRNGSITQIPILTMPNDD
ITHPIPDLTGYITEGQIYVDRQLHNRQIYPPINVLPSLSRLMKSAIGEGMTRKDHADVSN
QLYACYAIGKDVQAMKAVVGEEALTSDDLLYLEFLQKFEKNFITQGPYENRTVYETLDIG
WQLLRIFPKEMLKRIPQSTLSEFYPRDSAKH
NT seq 1536 nt   +upstreamnt  +downstreamnt
atggcgttgcgagcgatgcggggaatcgtgaacggggccgcgcccgagctgcccgtgccc
accggtgggccgatggccggagctcgggagcaggcgctggcggtgagccggaactacctc
tcccagcctcgtctcacctacaagactgtctctggagtgaatggtccactagtgatctta
gatcatgtaaagtttcccagatatgctgagattgtccacttgacattaccagatggcaca
aaaagaagtgggcaagttctagaagttagtggctccaaagccgtggttcaggtatttgaa
ggaacatccggcatagatgccaagaaaacatcctgtgagtttactggagatattctccgc
acaccagtgtctgaggatatgcttggtcgagtattcaatggatcaggaaaacccattgac
cgaggtcctgtggtgttggccgaagacttccttgacatcatgggtcagccaatcaaccct
cagtgtcgcatctacccagaagagatgattcagacgggcatttctgccatcgatggcatg
aacagtattgcgaggggacagaaaatccccatcttttctgctgccgggttaccacacaac
gagattgcagctcagatctgtcgccaggctggtttggtaaagaaatccaaagacgtggta
gactacagtgaagaaaactttgccattgtgtttgctgctatgggagtaaacatggaaaca
gcccggttcttcaaatctgactttgaagaaaatggctcaatggacaatgtctgccttttc
ttgaatctggctaatgacccaactatcgagaggatcatcactcctcgcctggctctgacc
accgctgagtttctggcttaccagtgtgagaagcatgtcctggtcatcctgacagatatg
agttcttacgctgaagcacttcgagaggtttcagctgccagggaagaggttcctggtcgg
cgaggcttccccggctacatgtatacggatttagccaccatctatgaacgcgctgggcga
gtggaaggtagaaatggctctattacccaaatccctattctcaccatgcccaatgatgat
atcactcatcctatccctgacttgactgggtatattactgagggccagatctatgtggac
agacagctgcacaacagacagatttaccctcctattaatgtgctgccctcactctctcgg
ttaatgaagtcagctattggagaaggaatgaccaggaaggatcatgctgatgtgtctaac
cagttgtacgcatgctatgctatcggtaaggatgtgcaagccatgaaagctgtggtggga
gaagaagccctgacctcagatgacctcctttacttggaatttctgcagaagtttgagaaa
aacttcattactcagggtccctatgaaaatcgaactgtctatgagactttggacattggc
tggcagttgcttcgaatcttccccaaagaaatgctgaagaggatccctcagagtaccctg
agcgaattttaccctcgagactctgcaaagcactag

KEGG   Rattus norvegicus (rat): 170667
Entry
170667            CDS       T01003                                 
Symbol
Atp6v0c
Name
(RefSeq) V-type proton ATPase 16 kDa proteolipid subunit
  KO
K02155  V-type H+-transporting ATPase 16kDa proteolipid subunit
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04142  Lysosome
rno04145  Phagosome
rno04721  Synaptic vesicle cycle
rno04966  Collecting duct acid secretion
rno05152  Tuberculosis
rno05165  Human papillomavirus infection
rno05323  Rheumatoid arthritis
Module
rno_M00160  V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    170667 (Atp6v0c)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    170667 (Atp6v0c)
   04142 Lysosome
    170667 (Atp6v0c)
 09150 Organismal Systems
  09155 Excretory system
   04966 Collecting duct acid secretion
    170667 (Atp6v0c)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    170667 (Atp6v0c)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    170667 (Atp6v0c)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    170667 (Atp6v0c)
  09163 Immune disease
   05323 Rheumatoid arthritis
    170667 (Atp6v0c)
SSDB
Motif
Pfam: ATP-synt_C
Other DBs
NCBI-GeneID: 170667
NCBI-ProteinID: NP_570836
RGD: 621394
Ensembl: ENSRNOG00000006542
UniProt: P63081
Structure
LinkDB
Position
10:complement(13196204..13202580)
AA seq 155 aa
MADIKNNPEYSSFFGVMGASSAMVFSAMGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVV
MAGIIAIYGLVVAVLIANSLTDGITLYRSFLQLGAGLSVGLSGLAAGFAIGIVGDAGVRG
TAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK
NT seq 468 nt   +upstreamnt  +downstreamnt
atggctgacatcaagaacaaccccgaatattcttcgtttttcggtgtcatgggcgcctcg
tccgccatggtcttcagcgccatgggagctgcctatggcacagccaagagtggcactggc
atcgcagccatgtcggtcatgaggccagagctgatcatgaagtccatcatcccagtggtt
atggctgggatcatcgccatctacggcctggtggttgcagtacttatcgctaactccctg
actgatggcatcaccctctacaggagttttcttcaactgggtgctggcctgagtgtgggg
ctgagtggcctggctgctggctttgccattggcattgtcggagatgctggtgtccggggc
actgcccagcagcctcgactgttcgtgggcatgatcctgatcctcatctttgcggaggtg
cttggcctctacggtctcatcgtggccctaatcctctccacaaagtag

KEGG   Rattus norvegicus (rat): 289407
Entry
289407            CDS       T01003                                 
Symbol
Atp6v1g3
Name
(RefSeq) V-type proton ATPase subunit G 3
  KO
K02152  V-type H+-transporting ATPase subunit G
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04145  Phagosome
rno04150  mTOR signaling pathway
rno04721  Synaptic vesicle cycle
rno04966  Collecting duct acid secretion
rno05165  Human papillomavirus infection
rno05323  Rheumatoid arthritis
Module
rno_M00160  V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    289407 (Atp6v1g3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    289407 (Atp6v1g3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    289407 (Atp6v1g3)
 09150 Organismal Systems
  09155 Excretory system
   04966 Collecting duct acid secretion
    289407 (Atp6v1g3)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    289407 (Atp6v1g3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    289407 (Atp6v1g3)
  09163 Immune disease
   05323 Rheumatoid arthritis
    289407 (Atp6v1g3)
SSDB
Motif
Pfam: V-ATPase_G RNase_Y_N Prp31_C V-ATPase_G_2 OmpH
Other DBs
NCBI-GeneID: 289407
NCBI-ProteinID: NP_001099461
RGD: 1304635
Ensembl: ENSRNOG00000022480
UniProt: D3ZTZ4
LinkDB
Position
13:49800256..49825247
AA seq 118 aa
MTSQSQGIQQLLQAEKRAKDKLDEAKKRKGKRLRQAKEEAVAETDQYRMQREKEFRLKQS
KIMGSQSHLSDELEEQTLEKIKELSGSYHKCMDSVIKQLLSMVCEMKPEVHVNYRATS
NT seq 357 nt   +upstreamnt  +downstreamnt
atgaccagccagtctcaggggattcaacagctcctgcaagcagagaaaagggccaaagac
aagctggatgaggcaaagaagagaaaaggaaagagactgaggcaagctaaggaagaagcc
gtggcagagaccgaccagtacagaatgcagagggagaaggagttccgcctgaagcagtct
aagataatgggctctcagagccacctctcggatgaactcgaagagcaaacactggagaag
ataaaggaattgagcggaagctaccacaagtgtatggacagcgtgattaagcagctgttg
agcatggtgtgtgagatgaaaccagaagtccacgtgaactacagagccaccagctga

KEGG   Rattus norvegicus (rat): 291969
Entry
291969            CDS       T01003                                 
Symbol
Atp6v0d1
Name
(RefSeq) V-type proton ATPase subunit d 1
  KO
K02146  V-type H+-transporting ATPase subunit d
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04142  Lysosome
rno04145  Phagosome
rno04721  Synaptic vesicle cycle
rno04966  Collecting duct acid secretion
rno05152  Tuberculosis
rno05165  Human papillomavirus infection
rno05203  Viral carcinogenesis
rno05323  Rheumatoid arthritis
Module
rno_M00160  V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    291969 (Atp6v0d1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    291969 (Atp6v0d1)
   04142 Lysosome
    291969 (Atp6v0d1)
 09150 Organismal Systems
  09155 Excretory system
   04966 Collecting duct acid secretion
    291969 (Atp6v0d1)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    291969 (Atp6v0d1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    291969 (Atp6v0d1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    291969 (Atp6v0d1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    291969 (Atp6v0d1)
  09163 Immune disease
   05323 Rheumatoid arthritis
    291969 (Atp6v0d1)
SSDB
Motif
Pfam: vATP-synt_AC39 Nab2p_Zf1
Other DBs
NCBI-GeneID: 291969
NCBI-ProteinID: NP_001011927
RGD: 1306159
Ensembl: ENSRNOG00000017235
Vega: OTTRNOG00000002201
UniProt: Q5M7T6 F7FFW7
Structure
LinkDB
Position
19:complement(33403352..33447357)
AA seq 351 aa
MSFFPELYFNVDNGYLEGLVRGLKAGVLSQADYLNLVQCETLEDLKLHLQSTDYGNFLAN
EASPLTVSVIDDKLKEKMVVEFRHMRNHAYEPLASFLDFITYSYMIDNVILLITGTLHQR
SIAELVPKCHPLGSFEQMEAVNIAQTPAELYNAILVDTPLAAFFQDCISEQDLDEMNIEI
IRNTLYKAYLESFYKFCTLLGGTTADAMCPILEFEADRRAFIITINSFGTELSKEDRAKL
FPHCGRLYPEGLAQLARADDYEQVKNVADYYPEYKLLFEGAGSNPGDKTLEDRFFEHEVK
LNKLAFLNQFHFGVFYAFVKLKEQECRNIVWIAECIAQRHRAKIDNYIPIF
NT seq 1056 nt   +upstreamnt  +downstreamnt
atgtcgttcttcccggagctttatttcaacgtggacaatggctacttggagggattagtg
cgcggcctgaaggccggggtgctcagccaggcggactacctcaacctggtgcagtgcgag
acgctcgaggacttgaaactgcacctgcagagtacagattatggcaacttcctggccaat
gaagcgtcacctctgacggtgtcagtcatcgatgacaagctcaaggagaagatggtagta
gagttccgccacatgagaaaccatgcctacgagccacttgccagcttcctggacttcatt
acttacagctacatgattgacaacgtgatcctgctcatcacgggcacactgcaccagcgt
tcaatagctgaacttgtgcccaagtgccatccgctaggcagttttgagcagatggaggct
gtgaacatcgcacagacacccgcagagctctacaatgccattctggtggacacgcccctg
gcggcttttttccaggactgcatctcagagcaggaccttgatgagatgaacattgagata
atccgaaacacgctttacaaggcttatctggagtccttctacaagttctgtactctgtta
gggggaaccacagctgatgccatgtgtcctatcctagagtttgaagcagatcgccgagct
ttcatcatcaccatcaactctttcggcacagagctttccaaggaggaccgtgccaagctc
tttccacactgtggccgactctaccctgagggcttggctcagctggctcgggctgatgac
tatgaacaggtcaagaatgtagctgattactacccggaatacaaactgctttttgagggt
gcaggtagcaatcctggagacaagaccctggaggaccgattctttgaacatgaggtgaag
ctgaacaagctggccttcctgaaccagttccactttggtgtcttttatgcctttgtgaag
cttaaggaacaggaatgtcgcaacattgtgtggattgctgagtgcattgcccagcgccat
cgcgccaagatcgacaactatatccccatcttctag

KEGG   Rattus norvegicus (rat): 293650
Entry
293650            CDS       T01003                                 
Symbol
Tcirg1
Name
(RefSeq) V-type proton ATPase 116 kDa subunit a
  KO
K02154  V-type H+-transporting ATPase subunit a
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04142  Lysosome
rno04145  Phagosome
rno04721  Synaptic vesicle cycle
rno04966  Collecting duct acid secretion
rno05152  Tuberculosis
rno05165  Human papillomavirus infection
rno05323  Rheumatoid arthritis
Module
rno_M00160  V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    293650 (Tcirg1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    293650 (Tcirg1)
   04142 Lysosome
    293650 (Tcirg1)
 09150 Organismal Systems
  09155 Excretory system
   04966 Collecting duct acid secretion
    293650 (Tcirg1)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    293650 (Tcirg1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    293650 (Tcirg1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    293650 (Tcirg1)
  09163 Immune disease
   05323 Rheumatoid arthritis
    293650 (Tcirg1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    293650 (Tcirg1)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   293650 (Tcirg1)
SSDB
Motif
Pfam: V_ATPase_I APG6_N FKS1_dom1 DUF2730
Other DBs
NCBI-GeneID: 293650
NCBI-ProteinID: NP_954520
RGD: 735136
Ensembl: ENSRNOG00000017220
UniProt: Q2I6B0
LinkDB
Position
1:complement(201127034..201138787)
AA seq 834 aa
MGSMFRSEEVALVQLLLPTASAYNCVSQLGELGLVEFRDLNESVSAFQRRFVVEVRRCEE
LEKTFTFLREEVQRAGLTLTPPEGTLPAPPPRDLLRIQEETDRLAQELRDVRGNQQALRA
QLHQLQLHSAVLGQSHAPPMAAVHTEGPTTERTPLLSATPGPHADLKVNFVAGAVEPCKA
AALERLLWRACRGFLIASFKETEGQLEDPVTGEPATWMTFVISYWGEQIGQKVRKITDCF
HCHVFPYLEQEEARLRTLQQLQQQSQELQEVLGETERFLSQVLGRVQQLLPPGQVQIRKM
KAVHLTLNQCSVNTTHKCLIAEVWCATRDLPTVQQALQSGSSEEGVSAVAHRIPCQDMPP
TLIRTNRFTSSFQGIVDAYGVGRYREVNPAPYTIITFPFLFAVMFGDVGHGLLMFLFALA
MVLTENQPAVKTTQNEIWQTFFGGRYLPLLMGLFSIYTGFIYNECFSRATTIFPSGWSVA
AMANQSGWSDEYLSQHPMLTLNPNITGVFLGPYPFGIDPIWSLATNHLSFLNSFKMKMSV
ILGVTHMAFGVFLSIFNHVHFGQAHRLLLETVPELIFLLGLFGYLVFLIVYKWLYVSAAS
ASSAPSILIHFINMFLFSQNPTNRLLFHGQVVVQYALVVLALATVPILLLGTPLYLLRQH
HRRNTQRRPTAGRQDEDSDKLLASPDASTLENSWSPDEEKAGSSGDEEAEFVPSEIFMHQ
AIHTIEFCLGCISNTASYLRLWALSLAHAQLSEVLWAMVMRIGLGMGREIGVASVVLVPV
FAAFAVLTVAILLVMEGLSAFLHALRLHWVEFQNKFYSGTGYKLSPFAFTVDSD
NT seq 2505 nt   +upstreamnt  +downstreamnt
atgggctccatgttccggagtgaagaggtggccttggtccagctcctgttgcccacagca
tctgcctacaactgtgtgagccagctgggtgagctgggcctcgtggagtttagagacctc
aacgagtcggtgagtgccttccagagacgcttcgtggtagaggtccggcgctgcgaggag
ctggagaagaccttcaccttcttgcgggaagaagtgcagcgggcaggcctgacactgacc
ccacccgaggggacactgccagcaccgcctccccgagacctgctgcgcatccaggaggaa
acggaccgcttggcccaggagcttcgggatgttcgaggcaaccaacaggcacttcgggcc
cagctgcaccagctacagctccactcagccgtgctgggccagagccacgcccctccgatg
gcagctgtccatacggagggacccaccactgagagaacacccctgctttcagccacccca
gggccacatgcagacctgaaggtcaattttgtggcaggtgctgtggagccttgcaaggct
gcagccctggagcgcctgctttggagagcttgccgcggcttcctcattgccagctttaag
gagactgaggggcagctggaggacccggtgacgggtgagcctgcaacttggatgaccttt
gtcatctcctactggggtgagcagatcggacagaaggttcggaagatcacagactgcttt
cactgtcatgtcttcccgtacctggagcaggaggaagcccggctcaggaccttgcagcag
ctgcagcagcagagccaggagcttcaggaggtcctgggggagacagaacggttcctgagc
caggtgttgggccgggtgcagcagctgctgcccccagggcaggtgcagatccggaagatg
aaggccgtgcacctgaccctcaaccagtgcagtgtgaacaccacacacaagtgcctcatt
gcggaggtctggtgtgccacgagggaccttcccactgtacagcaggcgctgcagagcggc
tcgagtgaggaaggagtgagtgctgtggctcaccgtatcccttgccaggacatgcctcca
actctcatcaggaccaaccgcttcacctccagcttccagggcattgtggatgcctatggt
gtgggccgatacagggaagtcaaccctgctccctacaccatcatcacattccccttcctc
tttgctgtgatgtttggcgacgtgggccacggactgctcatgtttctcttcgccctggct
atggtcctcactgagaaccaaccagctgtaaagaccacgcaaaatgagatctggcagacc
ttctttgggggtcgctacctacccctgctcatgggtctgttctccatctacacgggcttc
atctacaacgagtgcttcagccgagccaccactattttcccctcaggctggagtgtggct
gccatggccaaccagtcaggctggagtgacgagtatctgtcccagcaccccatgcttacc
ctgaaccctaacatcactggtgtcttcctcggaccttatcccttcggcattgacccgatc
tggagcctggccaccaaccacctgagcttcctcaactccttcaagatgaagatgtctgtc
atccttggggtcacacacatggcctttggggtgttcctcagcatcttcaaccatgtgcac
tttggccaggcccaccggctactgctggagaccgtgcctgagctcatcttcctgttgggc
ctctttggctaccttgttttcctcattgtctacaagtggctctacgtctcagctgccagc
gcctcctcggcccccagtatcctcattcacttcatcaatatgttcctcttctcccaaaac
cccaccaatcggctgctcttccacgggcaggtagtggtacagtatgcgctggtggtcctg
gctttggccacagttcctatcctgctgctgggcacacccttgtaccttctgcgccagcac
caccgaagaaacactcagagaaggcctacagcaggcagacaggatgaggacagtgacaag
cttctggcctccccggatgcttccaccttggagaacagctggagccctgatgaggagaag
gctgggagctcaggagatgaagaagctgagtttgtcccttcggagatcttcatgcaccaa
gccatccacaccattgagttctgcctgggctgcatctccaacacagcctcctacttgcgt
ctctgggccctgagcctggctcatgctcagctgtctgaggtcctgtgggccatggtgatg
cgcataggcctaggcatgggccgagagattggtgtggcatctgtggtgctggtccctgtg
tttgctgcctttgctgtgttgactgtggccatcttgctagtgatggaggggctctcagcc
ttcctacatgccctgcggttgcactgggtggagttccagaacaagttctattcagggacc
ggctacaagctcagccccttcgccttcactgtggacagtgactag

KEGG   Rattus norvegicus (rat): 296981
Entry
296981            CDS       T01003                                 
Symbol
Atp6v0a4
Name
(RefSeq) V-type proton ATPase 116 kDa subunit a
  KO
K02154  V-type H+-transporting ATPase subunit a
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04142  Lysosome
rno04145  Phagosome
rno04721  Synaptic vesicle cycle
rno04966  Collecting duct acid secretion
rno05152  Tuberculosis
rno05165  Human papillomavirus infection
rno05323  Rheumatoid arthritis
Module
rno_M00160  V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    296981 (Atp6v0a4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    296981 (Atp6v0a4)
   04142 Lysosome
    296981 (Atp6v0a4)
 09150 Organismal Systems
  09155 Excretory system
   04966 Collecting duct acid secretion
    296981 (Atp6v0a4)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    296981 (Atp6v0a4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    296981 (Atp6v0a4)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    296981 (Atp6v0a4)
  09163 Immune disease
   05323 Rheumatoid arthritis
    296981 (Atp6v0a4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    296981 (Atp6v0a4)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   296981 (Atp6v0a4)
SSDB
Motif
Pfam: V_ATPase_I IFP_35_N
Other DBs
NCBI-GeneID: 296981
NCBI-ProteinID: NP_001100061
RGD: 1305055
Ensembl: ENSRNOG00000013428
UniProt: D4A1H0
LinkDB
Position
4:complement(66760159..66842110)
AA seq 801 aa
MASVFRSEEMCLSQVFLQVEAAYCCVAELGELGLVQFKDLNANVNSFQRKFVNEVRRCES
LERILRFLEDEMQNEIIIQVPDKDPGTPLPREMITLETTLEKLEGELQEANQSHQALKKS
FLELTELKYLLKKTQDFFEVNLGFTAGVINRERMASFERLLWRVCRGNVYLKFSEMDTLL
EDPVTKEEIKKNIFIIFYQGEQLRLKIKKICDGFRATIYPCPEHAAERREMLASVNVRLE
DLITVITQTESHRQRLLQEAASNWHSWVIKVQKMKAVYHVLNMCNIDVTQQCIIAEIWFP
VADTRHIKKALEQGMELSGSSMVPIMTEVETKTDPPTFNRTNKFTAGFQNIVDAYGVGSY
REINPAPYTIITFPFLFAVMFGDCGHGMVMLMAALWMVLNERHLLAQKSTNEMWNIFFNG
RYLILLMGIFSIYTGLIYNDCFSKSFNIFGSSWSVQPMFRNGTWNAHVVEQNPYLQLDPA
IPGVYSGNPYPFGIDPIWNLASNKLTFLNSYKMKMSVILGIVHMIFGVILSLFNHIYFRR
TLNIILQFIPEMIFMLSLFGYLVFMIIFKWCQYDAHTSQKAPSILIHFIGMFLFDYDDSS
NAPLYGHQQEVQTFFVIIALVSVPWMLLIKPFILRAKHQKSQLQSFTIHEDAMEGPSVKK
TAGAHGTKEGHEEEFNFGDIFVHQAIHTIEYCLGCISNTASYLRLWALSLAHAELSEVLW
TMVMSIGLRLRGWGGLVGVFIIFAVFAVLTVAILLVMEGLSAFLHALRLHWVEFQNKFYE
GAGFKFSPFSFKHVLEGAAEE
NT seq 2406 nt   +upstreamnt  +downstreamnt
atggcgtctgtgtttcgaagtgaggagatgtgcttatcccaagtgtttctccaggtggag
gctgcatactgctgtgtggctgagctgggggagcttggtttggttcaattcaaagatctg
aacgcaaatgtaaacagcttccagaggaagtttgtgaatgaggtccgaagatgcgagtca
ctggagagaatcctccgttttctggaagatgagatgcaaaatgagattataatccaagtg
cctgacaaggatccagggacccctctgccccgggaaatgatcaccctggagactactctg
gagaagttggaaggagagctacaggaagccaaccagagccatcaggctttgaagaagagc
tttttggaactgacagagctcaaatacctcctgaagaaaacccaggacttttttgaggta
aacttagggttcacggccggtgtgataaacagggagaggatggcttccttcgagaggctg
ctgtggagagtttgccggggaaacgtatatttgaagttcagcgagatggacacacttctg
gaggatcctgtgacgaaagaagaaattaaaaagaatatattcatcatattttatcaagga
gaacagctcaggctgaaaatcaagaagatctgtgatgggtttcgtgctaccatctacccc
tgcccggagcatgcagccgagcgcagagagatgctggccagtgtcaatgtgaggctggaa
gacttaatcactgtcattacccaaacagagtctcaccgacagcgcctactgcaggaagca
gcttccaactggcactcgtgggtcatcaaagtacagaagatgaaggccgtctaccacgtg
ctgaacatgtgcaacatcgacgtcacccagcagtgcatcattgctgagatctggttccct
gtagcagacactagacacattaagaaggccctggagcaaggcatggaactcagtggctcc
tccatggtccccatcatgacagaagtggaaactaaaacagaccctcccaccttcaatagg
accaataaatttacagctggcttccagaacattgtcgatgcatatggtgtaggtagctac
cgagagataaacccagccccctatactatcatcaccttccccttcctgttcgctgtgatg
tttggagactgtggtcacgggatggtgatgctgatggccgccctgtggatggtcctaaat
gagagacacttgctggctcagaagagcaccaatgagatgtggaacatcttcttcaatggg
cgctatctgatcctcctcatgggcatcttctccatctacaccggcttgatctacaacgac
tgtttctccaaatcttttaacatctttggctcctcttggagtgtccagcctatgttcaga
aacggcacgtggaatgctcatgtcgtggaacagaatccgtatttgcagctggatccggcc
atcccaggagtgtattctggaaatccctacccatttgggattgatccgatttggaacctg
gcttcaaacaaactcacatttttaaactcctacaagatgaagatgtcggtcatcctggga
atcgttcatatgatcttcggtgttatcctcagcctcttcaatcacatctacttcagacga
accctcaacatcattctgcagttcatccccgagatgatttttatgctgagtctgtttgga
tacctggttttcatgatcattttcaagtggtgtcaatatgatgcccacacatcccagaag
gcacccagcatcctcatccacttcatcggcatgtttctgtttgactacgatgactcgtcc
aacgcacccctgtacggccatcagcaagaagtccagactttctttgtcattatagcgttg
gtgtctgtgccgtggatgcttttgattaagccatttatccttagagccaagcaccagaaa
tctcagctgcagtccttcacgatccatgaggatgccatggagggcccctctgttaagaag
actgcaggtgcccatgggacgaaggaaggacacgaggaggagttcaactttggagacatc
tttgtccaccaagccatccacaccattgagtactgcctgggctgcatctccaatacagcc
tcatatcttcggctgtgggctctcagcttggctcacgcagagctgtccgaggtactgtgg
accatggtgatgagcatcggccttcgcctccgaggctggggagggctcgttggtgtcttc
atcatttttgccgtcttcgccgtcctcacagttgccatcctcctcgttatggagggcctc
tcagcctttctgcacgccctccggctgcattgggtggaattccagaacaagttctacgag
ggggccggcttcaagttctcccccttctcctttaagcacgtcctggaaggggcggctgag
gagtag

KEGG   Rattus norvegicus (rat): 297566
Entry
297566            CDS       T01003                                 
Symbol
Atp6v1e1
Name
(RefSeq) V-type proton ATPase subunit E 1
  KO
K02150  V-type H+-transporting ATPase subunit E
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04145  Phagosome
rno04150  mTOR signaling pathway
rno04721  Synaptic vesicle cycle
rno04966  Collecting duct acid secretion
rno05165  Human papillomavirus infection
rno05323  Rheumatoid arthritis
Module
rno_M00160  V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    297566 (Atp6v1e1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    297566 (Atp6v1e1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    297566 (Atp6v1e1)
 09150 Organismal Systems
  09155 Excretory system
   04966 Collecting duct acid secretion
    297566 (Atp6v1e1)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    297566 (Atp6v1e1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    297566 (Atp6v1e1)
  09163 Immune disease
   05323 Rheumatoid arthritis
    297566 (Atp6v1e1)
SSDB
Motif
Pfam: vATP-synt_E DUF4288 NifW
Other DBs
NCBI-GeneID: 297566
NCBI-ProteinID: NP_942040
RGD: 735157
Ensembl: ENSRNOG00000011905
UniProt: Q6PCU2
Structure
LinkDB
Position
4:complement(154022360..154044486)
AA seq 226 aa
MALSDADVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMEYYEKK
EKQIEQQKKIQMSNLMNQARLKVLRARDDLITDLLNEAKQRLSKVVKDTTRYQVLLDGLV
LQGLYQLLEPRMIVRCRKQDFPLVKAAVQKAIPMYKIATKKDVDVQIDLEAYLPEDIAGG
VEIYNGDRKIKVSNTLESRLDLIAQQMMPEVRGALFGANANRKFLD
NT seq 681 nt   +upstreamnt  +downstreamnt
atggcgctcagcgatgcagatgtacagaagcagattaagcacatgatggctttcatcgaa
caagaagccaatgagaaagcagaagaaatcgatgcaaaggcagaagaagagttcaacatt
gagaaaggtcgtcttgtgcaaacccagagattgaagattatggaatactatgagaagaag
gaaaagcagatcgagcagcagaagaaaattcaaatgtccaacttgatgaatcaagcaaga
ctcaaagtcctcagagcaagagatgacctcatcactgatctgctgaatgaggcaaaacag
agactcagcaaggtggtaaaagatacgaccaggtaccaggtgctgctggatgggctggtc
ctccagggcttgtaccagctgttggaacctcgaatgattgtgcgctgcagaaaacaagat
ttccctttggtgaaggctgcagtacagaaagcaatacctatgtataaaattgccaccaaa
aaagatgttgacgtccagattgacctggaggcctacctgcctgaggacatagctggtgga
gttgaaatctataatggggaccgcaagataaaggtttccaacactctggaaagccgactg
gacctaatagcccagcagatgatgccagaagtccgcggagccttgtttggtgcaaatgcc
aataggaagtttctggactga

KEGG   Rattus norvegicus (rat): 29757
Entry
29757             CDS       T01003                                 
Symbol
Atp6v0a1
Name
(RefSeq) V-type proton ATPase 116 kDa subunit a1
  KO
K02154  V-type H+-transporting ATPase subunit a
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04142  Lysosome
rno04145  Phagosome
rno04721  Synaptic vesicle cycle
rno04966  Collecting duct acid secretion
rno05152  Tuberculosis
rno05165  Human papillomavirus infection
rno05323  Rheumatoid arthritis
Module
rno_M00160  V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    29757 (Atp6v0a1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    29757 (Atp6v0a1)
   04142 Lysosome
    29757 (Atp6v0a1)
 09150 Organismal Systems
  09155 Excretory system
   04966 Collecting duct acid secretion
    29757 (Atp6v0a1)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    29757 (Atp6v0a1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    29757 (Atp6v0a1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    29757 (Atp6v0a1)
  09163 Immune disease
   05323 Rheumatoid arthritis
    29757 (Atp6v0a1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    29757 (Atp6v0a1)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   29757 (Atp6v0a1)
SSDB
Motif
Pfam: V_ATPase_I
Other DBs
NCBI-GeneID: 29757
NCBI-ProteinID: NP_113792
RGD: 68405
Ensembl: ENSRNOG00000036814
UniProt: P25286 Q2I6B4 Q2I6B5
Structure
LinkDB
Position
10:85935802..85989901
AA seq 838 aa
MGELFRSEEMTLAQLFLQSEAAYCCVSELGELGKVQFRDLNPDVNVFQRKFVNEVRRCEE
MDRKLRFVEKEIRKANIPIMDTGENPEVPFPRDMIDLEANFEKIENELKEINTNQEALKR
NFLELTELKFILRKTQQFFDEMADPDLLEESSSLLEPNEMGRGAPLRLGFVAGVINRERI
PTFERMLWRVCRGNVFLRQAEIENPLEDPVTGDYVHKSVFIIFFQGDQLKNRVKKICEGF
RASLYPCPETPQERKEMASGVNTRIDDLQMVLNQTEDHRQRVLQAAAKNIRVWFIKVRKM
KAIYHTLNLCNIDVTQKCLIAEVWCPVTDLDSIQFALRRGTEHSGSTVPSILNRMQTNQT
PPTYNKTNKFTHGFQNIVDAYGIGTYREINPAPYTVITFPFLFAVMFGDFGHGILMTLFA
VWMVLRESRILSQKNENEMFSMVFSGRYIILLMGLFSIYTGLIYNDCFSKSLNIFGSSWS
VRPMFTIGNWTEETLLGSSVLQLNPAIPGVFGGPYPFGIDPIWNIATNKLTFLNSFKMKM
SVILGIIHMLFGVSLSLFNHIYFKKPLNIYFGFIPEIIFMSSLFGYLVILIFYKWTAYDA
HSSRNAPSLLIHFINMFLFSYPESGNAMLYSGQKGIQCFLIVVAMLCVPWMLLFKPLILR
HQYLRKKHLGTLNFGGIRVGNGPTEEDAEIIQHDQLSTHSEDAEEPTEDEVFDFGDTMVH
QAIHTIEYCLGCISNTASYLRLWALSLAHAQLSEVLWTMVIHIGLHVRSLAGGLGLFFIF
AAFATLTVAILLIMEGLSAFLHALRLHWVEFQNKFYTGTGFKFLPFSFEHIREGKFDE
NT seq 2517 nt   +upstreamnt  +downstreamnt
atgggggagcttttccgaagcgaggagatgaccctggcccagctctttctccagtccgaa
gctgcttattgttgtgtcagtgaattaggagaacttggaaaggttcagttccgggattta
aatccagatgtgaatgttttccagaggaaatttgtgaatgaagttagaagatgtgaagaa
atggatcgaaaactccggtttgttgagaaagagataagaaaagctaacatcccaattatg
gacactggagagaacccggaggtgccctttcccagggacatgatcgacttggaggccaat
ttcgagaagatcgaaaacgaactgaaggaaatcaacactaaccaggaagctctaaagcga
aacttcctggaactgactgaattaaaatttatactgcgcaaaactcagcagtttttcgat
gagatggcggatccagacctgttggaagagtcctcatcactcttggagccaaacgagatg
ggaagaggcgcgcctttacgacttggcttcgtagctggtgtgattaaccgggaacggatc
ccgacctttgagcgcatgctttggcgagtgtgccgagggaatgtgttcctgagacaggct
gaaatcgaaaacccgctggaggatcccgtgactggcgactacgtgcacaagtccgtgttc
atcatttttttccaaggtgaccagctgaaaaacagggtcaagaaaatctgtgaagggttc
cgagcctccctctatccctgtcctgagactccacaggagagaaaagaaatggcttccgga
gtcaataccaggatcgacgatctccaaatggttctgaatcagacagaggaccaccgccag
agggttctgcaggcggctgctaagaacatccgggtgtggttcatcaaggtgcggaagatg
aaagctatctaccataccctgaacctctgcaacatcgatgtgacgcagaagtgcctgatc
gcggaagtctggtgccccgtcactgacctggactccatccagtttgcactgcgaaggggc
acggagcacagcggttccactgtcccctccattctgaacaggatgcagacaaaccagaca
cccccgacgtataacaaaaccaacaagttcacgcacggcttccagaacatagtggatgct
tatgggatcggcacttaccgagaaattaacccagctccgtacaccgtcatcaccttcccc
tttctgtttgctgtgatgtttggagattttgggcacggcattttgatgactctgtttgct
gtgtggatggtgttgagggagagccggatcctctcccagaagaacgagaatgagatgttt
agcatggtgttcagcggccgatacattatccttctgatgggactgttctccatctacact
ggactcatctacaatgactgcttttccaagtctctgaatatctttgggtcatcatggagc
gtacggccaatgttcaccatagggaactggacggaggagacgctcctggggagttctgtc
ctccagctgaacccagctatccctggagtctttggtggcccttacccatttggcattgat
ccgatttggaacatcgcaaccaacaagctgaccttcctcaactccttcaagatgaagatg
tcagttattcttgggatcatccacatgctgttcggggtcagcctgagccttttcaaccac
atctatttcaagaagcccctgaacatctactttggctttattcccgagataatcttcatg
tcctcgctgtttggctacctggtcatcctcatcttttacaagtggacagcctacgatgcc
cactcgtctagaaatgccccgagcctcctgatccatttcataaacatgttcctcttctcc
tacccagagtctggtaacgcaatgctgtactctggacagaaaggaattcagtgtttcctc
atagtggtggcaatgctctgtgtcccctggatgctgctgtttaagccgttgatccttcgc
catcagtacctgaggaagaagcatttgggaactctcaactttggtgggatcagggtgggc
aacggaccgacagaggaggatgctgaaattattcagcatgaccagctctccacccattca
gaggacgcagaagagcctaccgaggacgaagtgtttgactttggcgacaccatggtccac
caggccatccacaccattgagtactgcttgggctgcatctccaacactgcgtcctacctg
cggctctgggccctcagcctggcccatgcacagctctctgaagtactctggaccatggtg
atccacatcggcctgcatgtccggagtctggcagggggactggggctgtttttcatcttc
gctgcctttgccaccctgaccgtggccatcctgctgatcatggaaggcctctcagccttc
ctccacgcactgcgattacactgggtggaattccagaacaaattctacactgggactggt
ttcaagttcctccccttctcctttgagcacattcgggaagggaagtttgatgagtga

DBGET integrated database retrieval system